Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2MA138)

DOT Name Protein FAM81A (FAM81A)
Gene Name FAM81A
UniProt ID
FA81A_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MENMHLRRVRTMPRHSQSLTMAPYSSVSLVEQLEDRILCHEKTTAALVEHAFRIKDDIVN
SLQKMQNKGGGDRLARLFLEEHIRNITAIVKQLNRDIEVLQEQIRARDNISYGTNSALKT
LEMRQLSGLGDLRGRVARCDASIARLSAEHKTTYEGLQHLNKEQQAAKLILETKIKDAEG
QISQLLNRVDLSISEQSTKLKMSHRDSNHQLQLLDTKFKGTVEELSNQILSARSWLQQEQ
ERIEKELLQKIDQLSLIVKENSGASERDMEKKLSQMSARLDKIEEGQKKTFDGQRTRQEE
EKMHGRITKLELQMNQNIKEMKAEVNAGFTAVYESIGSLRQVLEAKMKLDRDQLQKQIQL
MQKPETPM

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Protein FAM81A (FAM81A). [1]
Temozolomide DMKECZD Approved Temozolomide decreases the expression of Protein FAM81A (FAM81A). [2]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of Protein FAM81A (FAM81A). [3]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Protein FAM81A (FAM81A). [3]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Protein FAM81A (FAM81A). [4]
Amiodarone DMUTEX3 Phase 2/3 Trial Amiodarone increases the expression of Protein FAM81A (FAM81A). [5]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Protein FAM81A (FAM81A). [6]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Protein FAM81A (FAM81A). [7]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)

References

1 Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
2 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
3 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
4 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
5 Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
6 Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
7 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.