Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2XU9EU)

DOT Name Myozenin-1 (MYOZ1)
Synonyms Calsarcin-2; Filamin-, actinin- and telethonin-binding protein; Protein FATZ
Gene Name MYOZ1
Related Disease
Atrial fibrillation ( )
Dilated cardiomyopathy 1A ( )
Familial atrial fibrillation ( )
UniProt ID
MYOZ1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
7A8T; 7A8U; 7ANK
Pfam ID
PF05556
Sequence
MPLSGTPAPNKKRKSSKLIMELTGGGQESSGLNLGKKISVPRDVMLEELSLLTNRGSKMF
KLRQMRVEKFIYENHPDVFSDSSMDHFQKFLPTVGGQLGTAGQGFSYSKSNGRGGSQAGG
SGSAGQYGSDQQHHLGSGSGAGGTGGPAGQAGRGGAAGTAGVGETGSGDQAGGEGKHITV
FKTYISPWERAMGVDPQQKMELGIDLLAYGAKAELPKYKSFNRTAMPYGGYEKASKRMTF
QMPKFDLGPLLSEPLVLYNQNLSNRPSFNRTPIPWLSSGEPVDYNVDIGIPLDGETEEL
Function
Myozenins may serve as intracellular binding proteins involved in linking Z-disk proteins such as alpha-actinin, gamma-filamin, TCAP/telethonin, LDB3/ZASP and localizing calcineurin signaling to the sarcomere. Plays an important role in the modulation of calcineurin signaling. May play a role in myofibrillogenesis.
Tissue Specificity Expressed primarily in skeletal muscle. Detected at lower levels in heart, prostate and pancreas.
KEGG Pathway
Cytoskeleton in muscle cells (hsa04820 )

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Atrial fibrillation DIS15W6U Strong Biomarker [1]
Dilated cardiomyopathy 1A DIS0RK9Z Strong Biomarker [2]
Familial atrial fibrillation DISL4AGF moderate Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Myozenin-1 (MYOZ1). [3]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Myozenin-1 (MYOZ1). [4]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Myozenin-1 (MYOZ1). [6]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Myozenin-1 (MYOZ1). [5]
------------------------------------------------------------------------------------

References

1 Biobank-driven genomic discovery yields new insight into atrial fibrillation biology.Nat Genet. 2018 Sep;50(9):1234-1239. doi: 10.1038/s41588-018-0171-3. Epub 2018 Jul 30.
2 Mutations in PDLIM3 and MYOZ1 encoding myocyte Z line proteins are infrequently found in idiopathic dilated cardiomyopathy.Mol Genet Metab. 2007 Apr;90(4):435-40. doi: 10.1016/j.ymgme.2006.12.008. Epub 2007 Jan 24.
3 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
4 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
5 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
6 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.