Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT3UJ0GF)

DOT Name Ribosomal RNA processing protein 36 homolog (RRP36)
Gene Name RRP36
UniProt ID
RRP36_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF06102
Sequence
MPGANYRAGAGAGAGARRPRGARDREEDGGGLEPAAVARDLLRGTSNMSFEELLELQSQV
GTKTYKQLVAGNSPKKQASRPPIQNACVADKHRPLEMSAKIRVPFLRQVVPISKKVARDP
RFDDLSGEYNPEVFDKTYQFLNDIRAKEKELVKKQLKKHLSGEEHEKLQQLLQRMEQQEM
AQQERKQQQELHLALKQERRAQAQQGHRPYFLKKSEQRQLALAEKFKELKRSKKLENFLS
RKRRRNAGKDRRHLPLSKE
Function Involved in the early processing steps of the pre-rRNA in the maturation pathway leading to the 18S rRNA.
Reactome Pathway
Major pathway of rRNA processing in the nucleolus and cytosol (R-HSA-6791226 )
rRNA modification in the nucleus and cytosol (R-HSA-6790901 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Ribosomal RNA processing protein 36 homolog (RRP36). [1]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Ribosomal RNA processing protein 36 homolog (RRP36). [2]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of Ribosomal RNA processing protein 36 homolog (RRP36). [3]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Ribosomal RNA processing protein 36 homolog (RRP36). [4]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Ribosomal RNA processing protein 36 homolog (RRP36). [5]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Ribosomal RNA processing protein 36 homolog (RRP36). [6]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
3 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
4 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
5 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
6 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.