General Information of Drug Off-Target (DOT) (ID: OT41T0FB)

DOT Name Mis18-binding protein 1 (MIS18BP1)
Synonyms Kinetochore-associated protein KNL-2 homolog; HsKNL-2; P243
Gene Name MIS18BP1
UniProt ID
M18BP_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1WGX
Pfam ID
PF09133
Sequence
MIATPLKHSRIYLPPEASSQRRNLPMDAIFFDSIPSGTLTPVKDLVKYQNSSLKLNDHKK
NQFLKMTTFNNKNIFQSTMLTEATTSNSSLDISAIKPNKDGLKNKANYESPGKIFLRMKE
KVLRDKQEQPSRNSSLLEPQKSGNNETFTPNRVEKKKLQHTYLCEEKENNKSFQSDDSSL
RASVQGVPLESSNNDIFLPVKQKIQCQQEKKAPLHNLTYELPTLNQEQENFLAVEARNKT
LTRAQLAKQIFHSKESIVATTKSKKDTFVLESVDSADEQFQNTNAETLSTNCIPIKNGSL
LMVSDSERTTEGTSQQKVKEGNGKTVPGETGLPGSMKDTCKIVLATPRLHITIPRRSKRN
ISKLSPPRIFQTVTNGLKKNQVVQLQEWMIKSINNNTAICVEGKLIDVTNIYWHSNVIIE
RIEHNKLRTISGNVYILKGMIDQISMKEAGYPNYLIRKFMFGFPENWKEHIDNFLEQLRA
GEKNREKTKQKQKTGRSVRDIRKSMKNDARENQTDTAQRATTTYDFDCDNLELKSNKHSE
SPGATELNMCHSNCQNKPTLRFPDDQVNNTIQNGGGDDLSNQELIGKKEYKMSSKKLKIG
ERTNERIIKSQKQETTEELDVSIDILTSREQFFSDEERKYMAINQKKAYILVTPLKSRKV
IEQRCMRYNLSAGTIKAVTDFVIPECQKKSPISKSMGTLENTFEGHKSKNKEDCDERDLL
TVNRKIKISNLEKEQMLTSDFKKNTRLLPKLKKIENQVAMSFYKHQSSPDLSSEESETEK
EIKRKAEVKKTKAGNTKEAVVHLRKSTRNTSNIPVILEPETEESENEFYIKQKKARPSVK
ETLQKSGVRKEFPITEAVGSDKTNRHPLECLPGLIQDKEWNEKELQKLHCAFASLPKHKP
GFWSEVAAAVGSRSPEECQRKYMENPRGKGSQKHVTKKKPANSKGQNGKRGDADQKQTIK
ITAKVGTLKRKQQMREFLEQLPKDDHDDFFSTTPLQHQRILLPSFQDSEDDDDILPNMDK
NPTTPSSVIFPLVKTPQCQHVSPGMLGSINRNDCDKYVFRMQKYHKSNGGIVWGNIKKKL
VETDFSTPTPRRKTPFNTDLGENSGIGKLFTNAVESLDEEEKDYYFSNSDSA
Function Required for recruitment of CENPA to centromeres and normal chromosome segregation during mitosis.
Reactome Pathway
Deposition of new CENPA-containing nucleosomes at the centromere (R-HSA-606279 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
16 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Mis18-binding protein 1 (MIS18BP1). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Mis18-binding protein 1 (MIS18BP1). [2]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Mis18-binding protein 1 (MIS18BP1). [3]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Mis18-binding protein 1 (MIS18BP1). [4]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Mis18-binding protein 1 (MIS18BP1). [2]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of Mis18-binding protein 1 (MIS18BP1). [5]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of Mis18-binding protein 1 (MIS18BP1). [6]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Mis18-binding protein 1 (MIS18BP1). [5]
Azathioprine DMMZSXQ Approved Azathioprine decreases the expression of Mis18-binding protein 1 (MIS18BP1). [7]
Dasatinib DMJV2EK Approved Dasatinib decreases the expression of Mis18-binding protein 1 (MIS18BP1). [8]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Mis18-binding protein 1 (MIS18BP1). [11]
Geldanamycin DMS7TC5 Discontinued in Phase 2 Geldanamycin increases the expression of Mis18-binding protein 1 (MIS18BP1). [13]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Mis18-binding protein 1 (MIS18BP1). [14]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Mis18-binding protein 1 (MIS18BP1). [15]
Coumestrol DM40TBU Investigative Coumestrol increases the expression of Mis18-binding protein 1 (MIS18BP1). [16]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A decreases the expression of Mis18-binding protein 1 (MIS18BP1). [17]
------------------------------------------------------------------------------------
⏷ Show the Full List of 16 Drug(s)
4 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Mis18-binding protein 1 (MIS18BP1). [9]
TAK-243 DM4GKV2 Phase 1 TAK-243 increases the sumoylation of Mis18-binding protein 1 (MIS18BP1). [10]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 affects the phosphorylation of Mis18-binding protein 1 (MIS18BP1). [12]
Coumarin DM0N8ZM Investigative Coumarin increases the phosphorylation of Mis18-binding protein 1 (MIS18BP1). [12]
------------------------------------------------------------------------------------

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
3 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
4 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
5 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
6 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
7 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
8 Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
9 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
10 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
11 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
12 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
13 Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
14 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
15 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
16 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
17 Persistence of epigenomic effects after recovery from repeated treatment with two nephrocarcinogens. Front Genet. 2018 Dec 3;9:558.