Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OT45BDJU)
| DOT Name | Calcium channel flower homolog (CACFD1) | ||||
|---|---|---|---|---|---|
| Synonyms | Calcium channel flower domain-containing protein 1 | ||||
| Gene Name | CACFD1 | ||||
| Related Disease | |||||
| UniProt ID | |||||
| 3D Structure | |||||
| Pfam ID | |||||
| Sequence |
MSSSGGAPGASASSAPPAQEEGMTWWYRWLCRLSGVLGAVSCAISGLFNCITIHPLNIAA
GVWMIMNAFILLLCEAPFCCQFIEFANTVAEKVDRLRSWQKAVFYCGMAVVPIVISLTLT TLLGNAIAFATGVLYGLSALGKKGDAISYARIQQQRQQADEEKLAETLEGEL |
||||
| Function |
Transmembrane protein which mediates synaptic endocytosis and fitness-based cell culling. In response to different stimulus strengths, controls two major modes of synaptic vesicle (SV) retrieval in hippocampal neurons; Clathrin-mediated endocytosis (CME) in response to mild stimulation and activity-dependent bulk endocytosis (ADBE) in response to strong stimulation. In cytotoxic T-lymphoocytes (CTLs) facilitates calcium-dependent endocytosis of cytotoxic granules at the immuno synapse. Different isoforms work as fitness fingerprints in 'loser' and 'winner' cells and thereby mediate win/lose decisions as part of the cell competition process ; [Isoform 1]: Functions with the other flower isoforms to produce tissue-specific fitness fingerprints that identify unfit or fit cells during cell selection processes in order to maintain tissue health. During cell competition, if levels of this isoform in cells is higher than in the surrounding neighboring cells, the cells are recognized as 'winner' cells, and do not undergo elimination via apoptosis ; [Isoform 2]: Functions with the other flower isoforms to produce tissue-specific fitness fingerprints that identify unfit or fit cells during cell selection processes in order to maintain tissue health. During cell competition, if levels of this isoform in unfit cells is higher than in the surrounding neighboring cells, the cells are recognized as 'loser' cells, and undergo elimination via apoptosis to be replaced by the surrounding healthy 'winner' cell population ; [Isoform 3]: Functions with the other flower isoforms to produce tissue-specific fitness fingerprints that identify unfit or fit cells during cell selection processes in order to maintain tissue health. During cell competition, if levels of this isoform in unfit cells is higher than in the surrounding neighboring cells, the cells are recognized as 'loser' cells, and undergo elimination via apoptosis to be replaced by the surrounding healthy 'winner' cell population ; [Isoform 4]: Functions with the other flower isoforms to produce tissue-specific fitness fingerprints that identify unfit or fit cells during cell selection processes in order to maintain tissue health. During cell competition, if levels of this isoform in cells is higher than in the surrounding neighboring cells, the cells are recognized as 'winner' cells, and do not undergo elimination via apoptosis.
|
||||
| Tissue Specificity | Detected in skin cells at low levels of expression (at protein level). | ||||
Molecular Interaction Atlas (MIA) of This DOT
|
3 Disease(s) Related to This DOT
|
|||||||||||||||||||||||||||||||||||||||||||||
| Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
2 Drug(s) Affected the Post-Translational Modifications of This DOT
|
|||||||||||||||||||||||||||||||||||||||||||||
|
5 Drug(s) Affected the Gene/Protein Processing of This DOT
|
|||||||||||||||||||||||||||||||||||||||||||||
References