Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4OS3M2)

DOT Name	Neurensin-2 (NRSN2)
Gene Name	NRSN2
Related Disease	Epithelial ovarian cancer ( ) Hepatocellular carcinoma ( ) Ovarian cancer ( ) Ovarian neoplasm ( ) Advanced cancer ( ) Bone osteosarcoma ( ) Non-small-cell lung cancer ( ) Osteosarcoma ( )
UniProt ID	NRSN2_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF14927
Sequence	MMPSCNRSCSCSRGPSVEDGKWYGVRSYLHLFYEDCAGTALSDDPEGPPVLCPRRPWPSL CWKISLSSGTLLLLLGVAALTTGYAVPPKLEGIGEGEFLVLDQRAADYNQALGTCRLAGT ALCVAAGVLLAICLFWAMIGWLSQDTKAEPLDPEADSHVEVFGDEPEQQLSPIFRNASGQ SWFSPPASPFGQSSVQTIQPKRDS
Function	May play a role in maintenance and/or transport of vesicles.

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[1]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[2]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[1]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[1]
Advanced cancer	DISAT1Z9	moderate	Biomarker	[3]
Bone osteosarcoma	DIST1004	moderate	Biomarker	[2]
Non-small-cell lung cancer	DIS5Y6R9	moderate	Biomarker	[2]
Osteosarcoma	DISLQ7E2	moderate	Biomarker	[2]
------------------------------------------------------------------------------------


⏷ Show the Full List of 8 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Neurensin-2 (NRSN2).	[4]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Neurensin-2 (NRSN2).	[5]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Neurensin-2 (NRSN2).	[6]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Neurensin-2 (NRSN2).	[7]
Marinol	DM70IK5	Approved	Marinol increases the expression of Neurensin-2 (NRSN2).	[8]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Neurensin-2 (NRSN2).	[9]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Neurensin-2 (NRSN2).	[11]
------------------------------------------------------------------------------------


⏷ Show the Full List of 7 Drug(s)

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Neurensin-2 (NRSN2).	[10]
------------------------------------------------------------------------------------

References

1	Highly expressed NRSN2 is related to malignant phenotype in ovarian cancer.Biomed Pharmacother. 2017 Jan;85:248-255. doi: 10.1016/j.biopha.2016.11.012. Epub 2016 Nov 28.
2	NRSN2 promotes osteosarcoma cell proliferation and growth through PI3K/Akt/MTOR and Wnt/-catenin signaling.Am J Cancer Res. 2017 Mar 1;7(3):565-573. eCollection 2017.
3	Down-Regulated NRSN2 Promotes Cell Proliferation and Survival Through PI3K/Akt/mTOR Pathway in Hepatocellular Carcinoma.Dig Dis Sci. 2015 Oct;60(10):3011-8. doi: 10.1007/s10620-015-3736-3. Epub 2015 Jun 9.
4	Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
5	Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
6	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
7	Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
8	THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
9	Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
10	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
11	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.