Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5IC2M2)

• DOT Name: FMR1 neighbor protein (FMR1NB)
• Synonyms: Cancer/testis antigen 37; CT37; Sarcoma antigen NY-SAR-35
• Gene Name: FMR1NB
• Related Disease:
  Advanced cancer
  Glioma
  Hepatocellular carcinoma
  Lung adenocarcinoma
  Testicular cancer
• UniProt ID: FMR1N_HUMAN
• Sequence:
  MSSHRRKAKGRNRRSHRAMRVAHLELATYELAATESNPESSHPGYEAAMADRPQPGWRES
  LKMRVSKPFGMLMLSIWILLFVCYYLSYYLCSGSSYFVLANGHILPNSENAHGQSLEEDS
  ALEALLNFFFPTTCNLRENQVAKPCNELQDLSESECLRHKCCFSSSGTTSFKCFAPFRDV
  PKQMMQMFGLGAISLILVCLPIYCRSLFWRSEPADDLQRQDNRVVTGLKKQRRKRKRKSE
  MLQKAARGREEHGDE
• Tissue Specificity: Testis-specific. Expressed in melanoma, sarcoma, lung, breast, bladder, esophageal and ovarian cancers.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Biomarker	[1]
Glioma	DIS5RPEH	Strong	Biomarker	[2]
Hepatocellular carcinoma	DIS0J828	moderate	Biomarker	[1]
Lung adenocarcinoma	DISD51WR	moderate	Biomarker	[3]
Testicular cancer	DIS6HNYO	moderate	Biomarker	[4]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of FMR1 neighbor protein (FMR1NB).	[5]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate affects the expression of FMR1 neighbor protein (FMR1NB).	[6]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of FMR1 neighbor protein (FMR1NB).	[7]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of FMR1 neighbor protein (FMR1NB).	[8]

References

• [1] Effect of cancer/testis antigen NY-SAR-35 on the proliferation, migration and invasion of cancer cells.Oncol Lett. 2017 Feb;13(2):784-790. doi: 10.3892/ol.2016.5498. Epub 2016 Dec 14.
• [2] RETRACTED: NY-SAR-35 is involved in apoptosis, cell migration, invasion and epithelial to mesenchymal transition in glioma.Biomed Pharmacother. 2018 Jan;97:1632-1638. doi: 10.1016/j.biopha.2017.11.076. Epub 2017 Dec 6.
• [3] An Isolated TCR Restricted by HLA-A*02:01/CT37 Peptide Redirecting CD8(+) T Cells To Kill and Secrete IFN- in Response to Lung Adenocarcinoma Cell Lines.J Immunol. 2018 Apr 15;200(8):2965-2977. doi: 10.4049/jimmunol.1701054. Epub 2018 Mar 19.
• [4] A cancer/testis antigen, NY-SAR-35, induces EpCAM, CD44, and CD133, and activates ERK in HEK293 cells.Biochem Biophys Res Commun. 2017 Mar 4;484(2):298-303. doi: 10.1016/j.bbrc.2017.01.105. Epub 2017 Jan 23.
• [5] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Treatment of chronic lymphocytic leukemia with a hypomethylating agent induces expression of NXF2, an immunogenic cancer testis antigen. Clin Cancer Res. 2009 May 15;15(10):3406-15. doi: 10.1158/1078-0432.CCR-08-2099. Epub 2009 Apr 28.
• [8] Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.