Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5RRQ8E)

• DOT Name: Calcyphosin-like protein (CAPSL)
• Gene Name: CAPSL
• Related Disease: Multiple symmetric lipomatosis
• UniProt ID: CAPSL_HUMAN
• Pfam ID: PF13499
• Sequence:
  MAGTARHDREMAIQAKKKLTTATDPIERLRLQCLARGSAGIKGLGRVFRIMDDDNNRTLD
  FKEFMKGLNDYAVVMEKEEVEELFRRFDKDGNGTIDFNEFLLTLRPPMSRARKEVIMQAF
  RKLDKTGDGVITIEDLREVYNAKHHPKYQNGEWSEEQVFRKFLDNFDSPYDKDGLVTPEE
  FMNYYAGVSASIDTDVYFIIMMRTAWKL

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Multiple symmetric lipomatosis	DIS22LMD	Strong	Biomarker	[1]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Calcyphosin-like protein (CAPSL).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Calcyphosin-like protein (CAPSL).	[5]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Calcyphosin-like protein (CAPSL).	[6]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Phenobarbital	DMXZOCG	Approved	Phenobarbital decreases the expression of Calcyphosin-like protein (CAPSL).	[3]
Aspirin	DM672AH	Approved	Aspirin increases the expression of Calcyphosin-like protein (CAPSL).	[4]

References

• [1] Calcyphosine-like (CAPSL) is regulated in Multiple Symmetric Lipomatosis and is involved in Adipogenesis.Sci Rep. 2019 Jun 11;9(1):8444. doi: 10.1038/s41598-019-44382-1.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Dose- and time-dependent effects of phenobarbital on gene expression profiling in human hepatoma HepaRG cells. Toxicol Appl Pharmacol. 2009 Feb 1;234(3):345-60.
• [4] Expression profile analysis of colon cancer cells in response to sulindac or aspirin. Biochem Biophys Res Commun. 2002 Mar 29;292(2):498-512.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [6] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.