Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5TQQF8)

• DOT Name: Myb/SANT-like DNA-binding domain-containing protein 4 (MSANTD4)
• Synonyms: Myb/SANT-like DNA-binding domain containing 4 with coiled-coils
• Gene Name: MSANTD4
• UniProt ID: MSD4_HUMAN
• Pfam ID: PF13873
• Sequence:
  MKQLKRKRKSNFSVQETQTLLKEITKRKEVIFSKQLNTTINVMKRMAWEEIAQCVNAVGE
  GEQRTGTEVKRRYLDWRALMKRKRMKANIKLVGSGFPLPSSDLDDSLTEEIDEKIGFRND
  ANFDWQNVADFRDAGGSLTEVKVEEEERDPQSPEFEIEEEEEMLSSVIPDSRRENELPDF
  PHIDEFFTLNSTPSRSAYDEPHLLVNIEKQKLELEKRRLDIEAERLQVEKERLQIEKERL
  RHLDMEHERLQLEKERLQIEREKLRLQIVNSEKPSLENELGQGEKSMLQPQDIETEKLKL
  ERERLQLEKDRLQFLKFESEKLQIEKERLQVEKDRLRIQKEGHLQ

Molecular Interaction Atlas (MIA) of This DOT

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Myb/SANT-like DNA-binding domain-containing protein 4 (MSANTD4).	[1]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Myb/SANT-like DNA-binding domain-containing protein 4 (MSANTD4).	[2]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Myb/SANT-like DNA-binding domain-containing protein 4 (MSANTD4).	[3]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Myb/SANT-like DNA-binding domain-containing protein 4 (MSANTD4).	[5]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Myb/SANT-like DNA-binding domain-containing protein 4 (MSANTD4).	[4]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of Myb/SANT-like DNA-binding domain-containing protein 4 (MSANTD4).	[6]

References

• [1] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [2] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [3] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [4] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [5] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [6] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.