Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5YE5D5)

• DOT Name: Enkurin domain-containing protein 1 (ENKD1)
• Gene Name: ENKD1
• UniProt ID: ENKD1_HUMAN
• Pfam ID: PF13864
• Sequence:
  MCEGPSRISGPIPPDPTLCPDNYRRPTSAQGRLEGNALKLDLLTSDRALDTTAPRGPCIG
  PGAGEILERGQRGVGDVLLQLEGISLGPGASLKRKDPKDHEKENLRRIREIQKRFREQER
  SREQGQPRPLKALWRSPKYDKVESRVKAQLQEPGPASGTESAHFLRAHSRCGPGLPPPHV
  SSPQPTPPGPEAKEPGLGVDFIRHNARAAKRAPRRHSCSLQVLAQVLEQQRQAQEHYNAT
  QKGHVPHYLLERRDLWRREAEARKQSQPDPAMPPGHTRMPENQRLETLTKLLQSQSQLLR
  ELVLLPAGADSLRAQSHRAELDRKLVQVEEAIKIFSRPKVFVKMDD
• Function: Microtubule-binding protein which regulates microtubule organization and stability. Promotes the stability of astral microtubules and facilitates the proper orientation of the mitotic spindle. This allows the oriented division of basal keratinocytes and contributes to epidermal stratification. Required for the assembly of both primary and motile cilia. Destabilizes the interaction between CCP110 and CEP97 by competing with CEP97 for binding to CCP110 which promotes the removal of CCP110 and CEP97 from the mother centriole and allows the initiation of ciliogenesis.

Molecular Interaction Atlas (MIA) of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Enkurin domain-containing protein 1 (ENKD1).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Enkurin domain-containing protein 1 (ENKD1).	[2]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Enkurin domain-containing protein 1 (ENKD1).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Enkurin domain-containing protein 1 (ENKD1).	[4]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Enkurin domain-containing protein 1 (ENKD1).	[5]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Enkurin domain-containing protein 1 (ENKD1).	[6]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Enkurin domain-containing protein 1 (ENKD1).	[7]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Enkurin domain-containing protein 1 (ENKD1).	[8]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [3] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [4] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [5] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [6] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [7] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [8] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.