Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT658H5A)

• DOT Name: UPF0547 protein C16orf87 (C16ORF87)
• Gene Name: C16ORF87
• UniProt ID: CP087_HUMAN
• Pfam ID: PF10571
• Sequence:
  MSATRAKKVKMATKSCPECDQQVPVACKSCPCGYIFISRKLLNAKHSEKSPPSTENKHEA
  KRRRTERVRREKINSTVNKDLENRKRSRSNSHSDHIRRGRGRPKSASAKKHEEEREKQEK
  EIDIYANLSDEKAFVFSVALAEINRKIINQRLIL

Molecular Interaction Atlas (MIA) of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of UPF0547 protein C16orf87 (C16ORF87).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of UPF0547 protein C16orf87 (C16ORF87).	[2]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of UPF0547 protein C16orf87 (C16ORF87).	[4]
Irinotecan	DMP6SC2	Approved	Irinotecan decreases the expression of UPF0547 protein C16orf87 (C16ORF87).	[5]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of UPF0547 protein C16orf87 (C16ORF87).	[6]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of UPF0547 protein C16orf87 (C16ORF87).	[7]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of UPF0547 protein C16orf87 (C16ORF87).	[8]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of UPF0547 protein C16orf87 (C16ORF87).	[9]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of UPF0547 protein C16orf87 (C16ORF87).	[3]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of UPF0547 protein C16orf87 (C16ORF87).	[10]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [4] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [5] Clinical determinants of response to irinotecan-based therapy derived from cell line models. Clin Cancer Res. 2008 Oct 15;14(20):6647-55.
• [6] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [7] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [8] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [9] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [10] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.