Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6C2WXX)

• DOT Name: Protein GAPT (GAPT)
• Synonyms: GRB2-binding adapter protein, transmembrane; Growth factor receptor-bound protein 2-binding adapter protein, transmembrane
• Gene Name: GAPT
• Related Disease: Alzheimer disease
• UniProt ID: GAPT_HUMAN
• Pfam ID: PF11770
• Sequence:
  MSKSCGNNLAAISVGISLLLLLVVCGIGCVWHWKHRVATRFTLPRFLQRRSSRRKVCTKT
  FLGPRIIGLRHEISVETQDHKSAVRGNNTHDNYENVEAGPPKAKGKTDKELYENTGQSNF
  EEHIYGNETSSDYYNFQKPRPSEVPQDEDIYILPDSY
• Function: Negatively regulates B-cell proliferation following stimulation through the B-cell receptor. May play an important role in maintenance of marginal zone (MZ) B-cells.
• Tissue Specificity: Highly expressed in spleen and PBL, detected at lower levels in thymus, and undetectable in all other tissues tested. Also expressed in various B-cell lines, monocytic cell line THP-1 and NK-like cell line YT, but not in T-cell line Jurkat or HeLa cells.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Alzheimer disease	DISF8S70	Strong	Biomarker	[1]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Daunorubicin	DMQUSBT	Approved	Protein GAPT (GAPT) affects the response to substance of Daunorubicin.	[6]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Protein GAPT (GAPT).	[2]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Protein GAPT (GAPT).	[3]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Protein GAPT (GAPT).	[4]
Fenfluramine	DM0762O	Phase 3	Fenfluramine increases the expression of Protein GAPT (GAPT).	[5]

References

• [1] Effect of Chinese herbal compound GAPT on the early brain glucose metabolism of APP/PS1 transgenic mice.Int J Immunopathol Pharmacol. 2019 Jan-Dec;33:2058738419841482. doi: 10.1177/2058738419841482.
• [2] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [3] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [4] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [5] Fenfluramine-induced gene dysregulation in human pulmonary artery smooth muscle and endothelial cells. Pulm Circ. 2011 Jul-Sep;1(3):405-18. doi: 10.4103/2045-8932.87310.
• [6] Mapping genes that contribute to daunorubicin-induced cytotoxicity. Cancer Res. 2007 Jun 1;67(11):5425-33. doi: 10.1158/0008-5472.CAN-06-4431.