Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6IVKMB)

• DOT Name: Surfeit locus protein 2 (SURF2)
• Synonyms: Surf-2
• Gene Name: SURF2
• UniProt ID: SURF2_HUMAN
• Pfam ID: PF05477
• Sequence:
  MSELPGDVRAFLREHPSLRLQTDARKVRCILTGHELPCRLPELQVYTRGKKYQRLVRASP
  AFDYAEFEPHIVPSTKNPHQLFCKLTLRHINKCPEHVLRHTQGRRYQRALCKYEECQKQG
  VEYVPACLVHRRRRREDQMDGDGPRPREAFWEPTSSDEGGAASDDSMTDLYPPELFTRKD
  LGSTEDGDGTDDFLTDKEDEKAKPPREKATDEGRRETTVYRGLVQKRGKKQLGSLKKKFK
  SHHRKPKSFSSCKQPG

Molecular Interaction Atlas (MIA) of This DOT

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Surfeit locus protein 2 (SURF2).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Surfeit locus protein 2 (SURF2).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Surfeit locus protein 2 (SURF2).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Surfeit locus protein 2 (SURF2).	[4]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Surfeit locus protein 2 (SURF2).	[5]

References

• [1] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [2] Cyclosporine A--induced oxidative stress in human renal mesangial cells: a role for ERK 1/2 MAPK signaling. Toxicol Sci. 2012 Mar;126(1):101-13.
• [3] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.