Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6KI56F)

• DOT Name: Probable ribosome biogenesis protein RLP24 (RSL24D1)
• Synonyms: Ribosomal L24 domain-containing protein 1; Ribosomal protein L24-like
• Gene Name: RSL24D1
• UniProt ID: RLP24_HUMAN
• PDB ID: 6LSS ; 6LU8 ; 8FKP ; 8FKQ ; 8FKR ; 8FKS ; 8FKT ; 8FKU ; 8FKV ; 8FKW ; 8FKX ; 8FKY ; 8FKZ ; 8FL0 ; 8FL2 ; 8FL3 ; 8FL4 ; 8FL6 ; 8FL7 ; 8FL9 ; 8FLA ; 8FLB ; 8FLC ; 8FLD ; 8FLE ; 8FLF ; 8IDT ; 8IDY ; 8IE3 ; 8INE ; 8INF ; 8INK ; 8IPD ; 8IPX ; 8IPY ; 8IR1 ; 8IR3
• Pfam ID: PF01246
• Sequence:
  MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAG
  KELTVDNSFEFEKRRNEPIKYQRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQK
  VQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQQLQEDVDMEDAP
• Function: Involved in the biogenesis of the 60S ribosomal subunit. Ensures the docking of GTPBP4/NOG1 to pre-60S particles.
• KEGG Pathway:
  Ribosome (hsa03010)
  Coro.virus disease - COVID-19 (hsa05171)

Molecular Interaction Atlas (MIA) of This DOT

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Probable ribosome biogenesis protein RLP24 (RSL24D1).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Probable ribosome biogenesis protein RLP24 (RSL24D1).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Probable ribosome biogenesis protein RLP24 (RSL24D1).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Probable ribosome biogenesis protein RLP24 (RSL24D1).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Probable ribosome biogenesis protein RLP24 (RSL24D1).	[5]
Gemcitabine	DMSE3I7	Approved	Gemcitabine increases the expression of Probable ribosome biogenesis protein RLP24 (RSL24D1).	[6]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Probable ribosome biogenesis protein RLP24 (RSL24D1).	[7]
Torcetrapib	DMDHYM7	Discontinued in Phase 2	Torcetrapib increases the expression of Probable ribosome biogenesis protein RLP24 (RSL24D1).	[8]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Probable ribosome biogenesis protein RLP24 (RSL24D1).	[9]
chloropicrin	DMSGBQA	Investigative	chloropicrin affects the expression of Probable ribosome biogenesis protein RLP24 (RSL24D1).	[10]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Probable ribosome biogenesis protein RLP24 (RSL24D1).	[11]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [4] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Gene expression profiling of breast cancer cells in response to gemcitabine: NF-kappaB pathway activation as a potential mechanism of resistance. Breast Cancer Res Treat. 2007 Apr;102(2):157-72.
• [7] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [8] Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
• [9] Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
• [10] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [11] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.