Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6MZKQY)

DOT Name Natural cytotoxicity triggering receptor 1 (NCR1)
Synonyms Lymphocyte antigen 94 homolog; NK cell-activating receptor; Natural killer cell p46-related protein; NK-p46; NKp46; hNKp46; CD antigen CD335
Gene Name NCR1
UniProt ID
NCTR1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1OLL; 1P6F; 6IAP
Pfam ID
PF00047
Sequence
MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQL
HFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEM
YDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPV
TTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTET
GLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLN
TQTL
Function Cytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis.
Tissue Specificity Selectively expressed by both resting and activated NK cells.
KEGG Pathway
.tural killer cell mediated cytotoxicity (hsa04650 )
Reactome Pathway
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell (R-HSA-198933 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Natural cytotoxicity triggering receptor 1 (NCR1). [1]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Natural cytotoxicity triggering receptor 1 (NCR1). [2]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Natural cytotoxicity triggering receptor 1 (NCR1). [3]
Bortezomib DMNO38U Approved Bortezomib decreases the expression of Natural cytotoxicity triggering receptor 1 (NCR1). [4]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Natural cytotoxicity triggering receptor 1 (NCR1). [5]
BAY11-7082 DMQNOFA Investigative BAY11-7082 decreases the expression of Natural cytotoxicity triggering receptor 1 (NCR1). [4]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)

References

1 All-trans retinoic acid negatively regulates cytotoxic activities of nature killer cell line 92. Biochem Biophys Res Commun. 2007 Jan 5;352(1):42-7. doi: 10.1016/j.bbrc.2006.10.132. Epub 2006 Nov 2.
2 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
3 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
4 Proteasome inhibition induces apoptosis in primary human natural killer cells and suppresses NKp46-mediated cytotoxicity. Haematologica. 2009 Apr;94(4):470-8. doi: 10.3324/haematol.13783. Epub 2009 Feb 19.
5 Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.