Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT722OFZ)

• DOT Name: Glucose-fructose oxidoreductase domain-containing protein 2 (GFOD2)
• Synonyms: EC 1.-.-.-
• Gene Name: GFOD2
• UniProt ID: GFOD2_HUMAN
• EC Number: 1.-.-.-
• Pfam ID: PF01408
• Sequence:
  MKMLPGVGVFGTGSSARVLVPLLRAEGFTVEALWGKTEEEAKQLAEEMNIAFYTSRTDDI
  LLHQDVDLVCISIPPPLTRQISVKALGIGKNVVCEKAATSVDAFRMVTASRYYPQLMSLV
  GNVLRFLPAFVRMKQLISEHYVGAVMICDARIYSGSLLSPSYGWICDELMGGGGLHTMGT
  YIVDLLTHLTGRRAEKVHGLLKTFVRQNAAIRGIRHVTSDDFCFFQMLMGGGVCSTVTLN
  FNMPGAFVHEVMVVGSAGRLVARGADLYGQKNSATQEELLLRDSLAVGAGLPEQGPQDVP
  LLYLKGMVYMVQALRQSFQGQGDRRTWDRTPVSMAASFEDGLYMQSVVDAIKRSSRSGEW
  EAVEVLTEEPDTNQNLCEALQRNNL
• Function: Promotes matrix assembly.

Molecular Interaction Atlas (MIA) of This DOT

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Glucose-fructose oxidoreductase domain-containing protein 2 (GFOD2).	[1]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Glucose-fructose oxidoreductase domain-containing protein 2 (GFOD2).	[2]
Estradiol	DMUNTE3	Approved	Estradiol affects the expression of Glucose-fructose oxidoreductase domain-containing protein 2 (GFOD2).	[3]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Glucose-fructose oxidoreductase domain-containing protein 2 (GFOD2).	[5]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Glucose-fructose oxidoreductase domain-containing protein 2 (GFOD2).	[6]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Glucose-fructose oxidoreductase domain-containing protein 2 (GFOD2).	[7]
GALLICACID	DM6Y3A0	Investigative	GALLICACID decreases the expression of Glucose-fructose oxidoreductase domain-containing protein 2 (GFOD2).	[8]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Glucose-fructose oxidoreductase domain-containing protein 2 (GFOD2).	[4]

References

• [1] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [2] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [3] Identification of novel low-dose bisphenol a targets in human foreskin fibroblast cells derived from hypospadias patients. PLoS One. 2012;7(5):e36711. doi: 10.1371/journal.pone.0036711. Epub 2012 May 4.
• [4] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [5] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [6] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [7] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [8] Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.