Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7IHWOU)

• DOT Name: JNK1/MAPK8-associated membrane protein (JKAMP)
• Synonyms: JKAMP; JNK1-associated membrane protein; JAMP; Medulloblastoma antigen MU-MB-50.4
• Gene Name: JKAMP
• UniProt ID: JKAMP_HUMAN
• Pfam ID: PF05571
• Sequence:
  MAVDIQPACLGLYCGKTLLFKNGSTEIYGECGVCPRGQRTNAQKYCQPCTESPELYDWLY
  LGFMAMLPLVLHWFFIEWYSGKKSSSALFQHITALFECSMAAIITLLVSDPVGVLYIRSC
  RVLMLSDWYTMLYNPSPDYVTTVHCTHEAVYPLYTIVFIYYAFCLVLMMLLRPLLVKKIA
  CGLGKSDRFKSIYAALYFFPILTVLQAVGGGLLYYAFPYIILVLSLVTLAVYMSASEIEN
  CYDLLVRKKRLIVLFSHWLLHAYGIISISRVDKLEQDLPLLALVPTPALFYLFTAKFTEP
  SRILSEGANGH
• Function: Regulates the duration of MAPK8 activity in response to various stress stimuli. Facilitates degradation of misfolded endoplasmic reticulum (ER) proteins through the recruitment of components of the proteasome and endoplasmic reticulum-associated degradation (ERAD) system.

Molecular Interaction Atlas (MIA) of This DOT

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of JNK1/MAPK8-associated membrane protein (JKAMP).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of JNK1/MAPK8-associated membrane protein (JKAMP).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of JNK1/MAPK8-associated membrane protein (JKAMP).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of JNK1/MAPK8-associated membrane protein (JKAMP).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of JNK1/MAPK8-associated membrane protein (JKAMP).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of JNK1/MAPK8-associated membrane protein (JKAMP).	[6]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of JNK1/MAPK8-associated membrane protein (JKAMP).	[7]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of JNK1/MAPK8-associated membrane protein (JKAMP).	[8]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of JNK1/MAPK8-associated membrane protein (JKAMP).	[9]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A increases the expression of JNK1/MAPK8-associated membrane protein (JKAMP).	[10]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [8] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [9] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [10] Persistence of epigenomic effects after recovery from repeated treatment with two nephrocarcinogens. Front Genet. 2018 Dec 3;9:558.