Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7LTW6K)

DOT Name	Chondrosarcoma-associated gene 1 protein (CSAG1)
Synonyms	Cancer/testis antigen 24.1; CT24.1; Cancer/testis antigen CSAGE
Gene Name	CSAG1
Related Disease	Chondrosarcoma ( )
UniProt ID	CSAG1_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MSATTACWPAFTVLGEARGDQVDWSRLYRDTGLVKMSRKPRASSPFSNNHPSTPKRFPRQ PRREKGPVKEVPGTKGSP
Function	May play an important role in maintaining centrosome integrity during mitosis.
Tissue Specificity	Expressed in chondrosarcoma, melanoma, cartilage and testis, but not in other normal tissues.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Chondrosarcoma	DIS4I7JB	Strong	Altered Expression	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Chondrosarcoma-associated gene 1 protein (CSAG1).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Chondrosarcoma-associated gene 1 protein (CSAG1).	[5]
------------------------------------------------------------------------------------

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Chondrosarcoma-associated gene 1 protein (CSAG1).	[3]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Chondrosarcoma-associated gene 1 protein (CSAG1).	[4]
------------------------------------------------------------------------------------

References

1	Cancer/testis antigen CSAGE is concurrently expressed with MAGE in chondrosarcoma.Gene. 2002 Feb 20;285(1-2):269-78. doi: 10.1016/s0378-1119(02)00395-5.
2	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3	Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
4	Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
5	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.