Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7MCG86)

DOT Name	Small nuclear protein PRAC1 (PRAC1)
Synonyms	Prostate cancer susceptibility candidate protein 1; Prostate, rectum and colon expressed gene protein
Gene Name	PRAC1
Related Disease	Benign prostatic hyperplasia ( ) Prostate cancer ( ) Prostate carcinoma ( )
UniProt ID	PRAC1_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MLCAHFSDQGPAHLTTSKSAFLSNKKTSTLKHLLGETRSDGSACNSGISGGRGRKIP
Tissue Specificity	Highly expressed in prostate, rectum, and distal colon, and weakly expressed in bladder. Expressed in prostate cancer cell lines.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Benign prostatic hyperplasia	DISI3CW2	Strong	Biomarker	[1]
Prostate cancer	DISF190Y	Strong	Genetic Variation	[2]
Prostate carcinoma	DISMJPLE	Strong	Genetic Variation	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Small nuclear protein PRAC1 (PRAC1).	[3]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Small nuclear protein PRAC1 (PRAC1).	[4]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Small nuclear protein PRAC1 (PRAC1).	[5]
------------------------------------------------------------------------------------

References

1	Aberrant expression of the PRAC gene in prostate cancer.Int J Oncol. 2013 Dec;43(6):1960-6. doi: 10.3892/ijo.2013.2117. Epub 2013 Oct 2.
2	Inflammation-associated DNA methylation patterns in epithelium of ulcerative colitis.Epigenetics. 2017 Aug;12(8):591-606. doi: 10.1080/15592294.2017.1334023. Epub 2017 May 30.
3	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
4	Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
5	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.