Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7MUY3B)

• DOT Name: Polyadenylate-binding protein-interacting protein 2B (PAIP2B)
• Synonyms: PABP-interacting protein 2B; PAIP-2B; Poly(A)-binding protein-interacting protein 2B
• Gene Name: PAIP2B
• Related Disease:
  Advanced cancer
  Neoplasm
  Pancreatic cancer
• UniProt ID: PAI2B_HUMAN
• Pfam ID: PF07145
• Sequence:
  MNGSNMANTSPSVKSKEDQGLSGHDEKENPFAEYMWMENEEDFNRQVEEELQEQDFLDRC
  FQEMLDEEDQDWFIPSRDLPQAMGQLQQQLNGLSVSEGHDSEDILSKSNLNPDAKEFIPG
  EKY
• Function: Inhibits translation of capped and polyadenylated mRNAs by displacing PABPC1 from the poly(A) tail.
• Tissue Specificity: Expressed in brain, cervix, heart, liver, ovary, kidney, prostate and testis.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[1]
Neoplasm	DISZKGEW	Strong	Biomarker	[1]
Pancreatic cancer	DISJC981	Strong	Biomarker	[1]

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Polyadenylate-binding protein-interacting protein 2B (PAIP2B).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Polyadenylate-binding protein-interacting protein 2B (PAIP2B).	[3]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Polyadenylate-binding protein-interacting protein 2B (PAIP2B).	[4]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Polyadenylate-binding protein-interacting protein 2B (PAIP2B).	[5]
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the expression of Polyadenylate-binding protein-interacting protein 2B (PAIP2B).	[6]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Polyadenylate-binding protein-interacting protein 2B (PAIP2B).	[7]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Polyadenylate-binding protein-interacting protein 2B (PAIP2B).	[8]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Polyadenylate-binding protein-interacting protein 2B (PAIP2B).	[9]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Polyadenylate-binding protein-interacting protein 2B (PAIP2B).	[10]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Polyadenylate-binding protein-interacting protein 2B (PAIP2B).	[11]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Polyadenylate-binding protein-interacting protein 2B (PAIP2B).	[12]

References

• [1] Genetic polymorphisms associated with pancreatic cancer survival: a genome-wide association study.Int J Cancer. 2017 Aug 15;141(4):678-686. doi: 10.1002/ijc.30762. Epub 2017 May 15.
• [2] Antiepileptic drugs are endocrine disruptors for the human fetal testis ex vivo. Toxicol Sci. 2023 Sep 28;195(2):169-183. doi: 10.1093/toxsci/kfad076.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [5] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [6] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [7] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [8] BET inhibition as a single or combined therapeutic approach in primary paediatric B-precursor acute lymphoblastic leukaemia. Blood Cancer J. 2013 Jul 19;3(7):e126. doi: 10.1038/bcj.2013.24.
• [9] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [10] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [11] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [12] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.