Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7UW9HA)

• DOT Name: Alpha-1-antitrypsin-related protein (SERPINA2)
• Synonyms: AAT-related protein; Protease inhibitor 1-like; Serpin A2
• Gene Name: SERPINA2
• Related Disease:
  Juvenile idiopathic arthritis
  Prostate cancer
  Prostate carcinoma
  Coronary heart disease
  Advanced cancer
• UniProt ID: A1ATR_HUMAN
• Pfam ID: PF00079
• Sequence:
  MPFSVSWGILLLAGLCCLVPSSLVEDPQEDAAQKTDTSHHDQGDWEDLACQKISYNVTDL
  AFDLYKELADLSQTSNVLVTPTSVAMAFAMLSLGTKADTRTEILEGLNVNLTETPEAKIH
  ECFQQVLQALSRPDTRLQLTTGSSLFVNKSMKLVDTFLEDTKKLYHSEASSINFRDTEEA
  KEQINNYVEKRTGRKVVDLVKHLKKDTSLALVDYISFHGKWKDKFKAEHIMVEGFHVDDK
  TIIRVPMINHLGRFDIHRDRELSSWVLAQHYVGNATAFFILPDPKKMWQLEEKLTYSHLE
  NIQRAFDIRSINLHFPKLSISGTYKLKRVLRNLGITKIFSNEADLSGVSQEAPLKLSKAV
  HVAVLTIDEKGTEATGAPHLEEKAWSKYQTVMFNRPFLVIIKDDITNFPLFIGKVVNPTQ
  K
• Function: Putative serine protease inhibitor.
• Tissue Specificity: Expressed in the liver, leukocytes and testis. Also detected in brain, colon, uterus, esophagus, spleen, trachea, kidney and lung.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Juvenile idiopathic arthritis	DISQZGBV	Strong	Altered Expression	[1]
Prostate cancer	DISF190Y	Strong	Biomarker	[2]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[2]
Coronary heart disease	DIS5OIP1	moderate	Genetic Variation	[3]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[4]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Phencyclidine	DMQBEYX	Investigative	Phencyclidine decreases the expression of Alpha-1-antitrypsin-related protein (SERPINA2).	[5]

References

• [1] Juvenile idiopathic arthritis patients have a distinct cartilage and bone biomarker profile that differs from healthy and knee-injured children.Clin Exp Rheumatol. 2020 Mar-Apr;38(2):355-365. doi: 10.55563/clinexprheumatol/ck090i. Epub 2019 Oct 30.
• [2] Human prostate-infiltrating CD8+ T lymphocytes are oligoclonal and PD-1+.Prostate. 2009 Nov 1;69(15):1694-703. doi: 10.1002/pros.21020.
• [3] Identification of 64 Novel Genetic Loci Provides an Expanded View on the Genetic Architecture of Coronary Artery Disease.Circ Res. 2018 Feb 2;122(3):433-443. doi: 10.1161/CIRCRESAHA.117.312086. Epub 2017 Dec 6.
• [4] Targeting ATR in vivo using the novel inhibitor VE-822 results in selective sensitization of pancreatic tumors to radiation. Cell Death Dis. 2012 Dec 6;3:e441.
• [5] Microarray Analysis of Gene Expression Alteration in Human Middle Ear Epithelial Cells Induced by Asian Sand Dust. Clin Exp Otorhinolaryngol. 2015 Dec;8(4):345-53. doi: 10.3342/ceo.2015.8.4.345. Epub 2015 Nov 10.