Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7ZUKW6)

• DOT Name: Stathmin-4 (STMN4)
• Synonyms: Stathmin-like protein B3; RB3
• Gene Name: STMN4
• Related Disease:
  Autism
  Neoplasm
  Neuroblastoma
• UniProt ID: STMN4_HUMAN
• PDB ID: 6BR1; 6BRF; 6BRY; 6NNG; 6O5M; 6O5N; 6O61; 6PC4; 7CPD
• Pfam ID: PF00836
• Sequence:
  MTLAAYKEKMKELPLVSLFCSCFLADPLNKSSYKYEADTVDLNWCVISDMEVIELNKCTS
  GQSFEVILKPPSFDGVPEFNASLPRRRDPSLEEIQKKLEAAEERRKYQEAELLKHLAEKR
  EHEREVIQKAIEENNNFIKMAKEKLAQKMESNKENREAHLAAMLERLQEKDKHAEEVRKN
  KELKEEASR
• Function: Exhibits microtubule-destabilizing activity.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Autism	DISV4V1Z	Strong	Genetic Variation	[1]
Neoplasm	DISZKGEW	Limited	Altered Expression	[2]
Neuroblastoma	DISVZBI4	Limited	Biomarker	[2]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Cytarabine	DMZD5QR	Approved	Stathmin-4 (STMN4) increases the response to substance of Cytarabine.	[9]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Stathmin-4 (STMN4).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Stathmin-4 (STMN4).	[4]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Stathmin-4 (STMN4).	[4]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Stathmin-4 (STMN4).	[5]
Amphotericin B	DMTAJQE	Approved	Amphotericin B increases the expression of Stathmin-4 (STMN4).	[6]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Stathmin-4 (STMN4).	[7]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Stathmin-4 (STMN4).	[8]

References

• [1] A novel 6.14 Mb duplication of chromosome 8p21 in a patient with autism and self mutilation.J Autism Dev Disord. 2009 Feb;39(2):322-9. doi: 10.1007/s10803-008-0627-x. Epub 2008 Aug 12.
• [2] Identification and characterisation of STMN4 and ROBO2 gene involvement in neuroblastoma cell differentiation.Cancer Lett. 2013 Jan 1;328(1):168-75. doi: 10.1016/j.canlet.2012.08.015. Epub 2012 Aug 17.
• [3] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [4] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [5] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [6] Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
• [7] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [9] Genome-wide local ancestry approach identifies genes and variants associated with chemotherapeutic susceptibility in African Americans. PLoS One. 2011;6(7):e21920. doi: 10.1371/journal.pone.0021920. Epub 2011 Jul 6.