Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT88DXU7)

• DOT Name: Basal body-orientation factor 1 (BBOF1)
• Synonyms: Coiled-coil domain-containing protein 176
• Gene Name: BBOF1
• Related Disease: Polycystic ovarian syndrome
• UniProt ID: BBOF1_HUMAN
• Pfam ID: PF14988
• Sequence:
  MPSKGKDKKKGKSKGKDTKKLIKTDESVVDRAKANASLWEARLEVTELSRIKYRDTSRIL
  AKSNEDLKKKQCKMEKDIMSVLSYLKKQDQEKDNMIEKLKQQLNETKEKAQEEKDKLEQK
  YTRQINELEGQFHQKAKEIGMIHTELKAVRQFQKRKIQVERELDDLKENLRNTERIHQET
  LRRLESRFFEEKHRLEQEAEKKIIMLAERAHHEAIVQLNDAGRNVFKENDYLQKALAYHL
  KETDALQKNSQKLQESHTLLLHQKEINDLLVKEKIMQLVQQRSQIQTLQKKVVNLETALS
  YMTKEFESEVLKLQQHAMIENQAGQVEIDKLQHLLQMKDREMNRVKKLAKNILDERTEVE
  RFFLDALHQVKQQILISRKHYKQIAQAAFNLKMRAACTGRTEYPKIRTFDGREHSTNSVN
  QDLLEAEKWTHIEGNVDIGDLTWEQKEKVLRLLFAKMNGCPSRKYNQSSRPPVPDYVVSD
  SGETKEFGDESKLQDKIFITQQIAISDSSGEVVLPTIPKEPQESDTGTF
• Function: Plays an essential role in sperm motility and male fertility by stabilizing the sperm flagellar axonemal structure. May be required for the stability of ODF2 and MANS1 proteins. Dispensable for the assembly and function of motile cilia.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Polycystic ovarian syndrome	DISZ2BNG	Strong	Biomarker	[1]

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Basal body-orientation factor 1 (BBOF1).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Basal body-orientation factor 1 (BBOF1).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Basal body-orientation factor 1 (BBOF1).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Basal body-orientation factor 1 (BBOF1).	[5]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Basal body-orientation factor 1 (BBOF1).	[6]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Basal body-orientation factor 1 (BBOF1).	[7]
Aspirin	DM672AH	Approved	Aspirin increases the expression of Basal body-orientation factor 1 (BBOF1).	[8]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Basal body-orientation factor 1 (BBOF1).	[9]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Basal body-orientation factor 1 (BBOF1).	[11]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Basal body-orientation factor 1 (BBOF1).	[12]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Basal body-orientation factor 1 (BBOF1).	[10]

References

• [1] Progesterone resistance in PCOS endometrium: a microarray analysis in clomiphene citrate-treated and artificial menstrual cycles.J Clin Endocrinol Metab. 2011 Jun;96(6):1737-46. doi: 10.1210/jc.2010-2600. Epub 2011 Mar 16.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [6] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [7] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [8] Expression profile analysis of colon cancer cells in response to sulindac or aspirin. Biochem Biophys Res Commun. 2002 Mar 29;292(2):498-512.
• [9] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [10] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [11] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [12] Isobaric tags for relative and absolute quantitation-based proteomics analysis of the effect of ginger oil on bisphenol A-induced breast cancer cell proliferation. Oncol Lett. 2021 Feb;21(2):101. doi: 10.3892/ol.2020.12362. Epub 2020 Dec 8.