Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT88U8X5)

DOT Name Serine/threonine-protein phosphatase CPPED1 (CPPED1)
Synonyms EC 3.1.3.16; Calcineurin-like phosphoesterase domain-containing protein 1; Complete S-transactivated protein 1
Gene Name CPPED1
UniProt ID
CPPED_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
3.1.3.16
Pfam ID
PF00149
Sequence
MSAAEAGGVFHRARGRTLAAFPAEKESEWKGPFYFILGADPQFGLIKAWSTGDCDNGGDE
WEQEIRLTEQAVQAINKLNPKPKFFVLCGDLIHAMPGKPWRTEQTEDLKRVLRAVDRAIP
LVLVSGNHDIGNTPTAETVEEFCRTWGDDYFSFWVGGVLFLVLNSQFYENPSKCPSLKQA
QDQWLDEQLSIARQRHCQHAIVFQHIPLFLESIDEDDDYYFNLSKSTRKKLADKFIHAGV
KVVFSGHYHRNAGGTYQNLDMVVSSAIGCQLGRDPHGLRVVVVTAEKIVHRYYSLDELSE
KGIEDDLMDLIKKK
Function
Protein phosphatase that dephosphorylates AKT family kinase specifically at 'Ser-473', blocking cell cycle progression and promoting cell apoptosis. May play an inhibitory role in glucose uptake by adipocytes.
Tissue Specificity Expressed in subcutaneous adipose tissue.
Reactome Pathway
Neutrophil degranulation (R-HSA-6798695 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
12 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Serine/threonine-protein phosphatase CPPED1 (CPPED1). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Serine/threonine-protein phosphatase CPPED1 (CPPED1). [2]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Serine/threonine-protein phosphatase CPPED1 (CPPED1). [3]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Serine/threonine-protein phosphatase CPPED1 (CPPED1). [4]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Serine/threonine-protein phosphatase CPPED1 (CPPED1). [5]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Serine/threonine-protein phosphatase CPPED1 (CPPED1). [6]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of Serine/threonine-protein phosphatase CPPED1 (CPPED1). [7]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Serine/threonine-protein phosphatase CPPED1 (CPPED1). [8]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Serine/threonine-protein phosphatase CPPED1 (CPPED1). [9]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Serine/threonine-protein phosphatase CPPED1 (CPPED1). [10]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Serine/threonine-protein phosphatase CPPED1 (CPPED1). [11]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Serine/threonine-protein phosphatase CPPED1 (CPPED1). [12]
------------------------------------------------------------------------------------
⏷ Show the Full List of 12 Drug(s)

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3 Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
4 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
5 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
6 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
7 Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
8 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
9 Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
10 Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
11 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
12 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.