Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT898DIJ)

DOT Name UPF0598 protein C8orf82 (C8ORF82)
Gene Name C8ORF82
UniProt ID
CH082_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF14956
Sequence
MWPPCGTLRTLALARSRGARACSGDGGVSYTQGQSPEPRTREYFYYVDHQGQLFLDDSKM
KNFITCFKDPQFLVTFFSRLRPNRSGRYEAAFPFLSPCGRERNFLRCEDRPVVFTHLLTA
DHGPPRLSYCGGGEALAVPFEPARLLPLAANGRLYHPAPERAGGVGLVRSALAFELSACF
EYGPGAPALPSHVRWQGRRLALTMDLAPLLLAARSP

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of UPF0598 protein C8orf82 (C8ORF82). [1]
------------------------------------------------------------------------------------
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Estradiol DMUNTE3 Approved Estradiol decreases the expression of UPF0598 protein C8orf82 (C8ORF82). [2]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of UPF0598 protein C8orf82 (C8ORF82). [3]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of UPF0598 protein C8orf82 (C8ORF82). [3]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of UPF0598 protein C8orf82 (C8ORF82). [4]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of UPF0598 protein C8orf82 (C8ORF82). [5]
------------------------------------------------------------------------------------

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
3 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
4 Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
5 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.