Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT8FDG3A)

• DOT Name: Uncharacterized protein C16orf46 (C16ORF46)
• Gene Name: C16ORF46
• UniProt ID: CP046_HUMAN
• Pfam ID: PF15032
• Sequence:
  MDLCQKNETDLENAENNEIQFTEETEPTYTCPDGKSEKNHVYCLLDVSDITLEQDEKAKE
  FIIGTGWEEAVQGWGRTSPAACIWPRKIPKKARVGEGACSDCLVCVNLSHWSLQTKPPTE
  GGPEKDQSSPSQTQAAPQGPSTASRAISDICFPTYFRAEKKSLQIKEFIWCNKDWAIPGT
  NRGKASGNPSGGAHRGLSIPGPLTSRALLVLPPLKASLSNALDVLGKKSKNSFLQSEEKV
  LDVEKDGCVAYAYGLKTADGKGEKRASELAKHPMVNDTPSSPSPAAQISLLTDPEQRCLH
  WSLLSEKNLACPPDPSNVRYLAALQLLQKRGVQSYKSKFKAKEPRSPVITRKHVLPKAKQ
  ENRPQMLETKVFPRPVLPSLTVSRVIIPVSTHRIL

Molecular Interaction Atlas (MIA) of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Uncharacterized protein C16orf46 (C16ORF46).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Uncharacterized protein C16orf46 (C16ORF46).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Uncharacterized protein C16orf46 (C16ORF46).	[3]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone decreases the expression of Uncharacterized protein C16orf46 (C16ORF46).	[5]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate decreases the expression of Uncharacterized protein C16orf46 (C16ORF46).	[6]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Uncharacterized protein C16orf46 (C16ORF46).	[7]
PMID27336223-Compound-5	DM6E50A	Patented	PMID27336223-Compound-5 decreases the expression of Uncharacterized protein C16orf46 (C16ORF46).	[5]
Cordycepin	DM72Y01	Investigative	Cordycepin decreases the expression of Uncharacterized protein C16orf46 (C16ORF46).	[8]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of Uncharacterized protein C16orf46 (C16ORF46).	[4]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [3] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [4] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [5] PPARgamma controls CD1d expression by turning on retinoic acid synthesis in developing human dendritic cells. J Exp Med. 2006 Oct 2;203(10):2351-62.
• [6] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [7] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [8] Cordycepin inhibits the proliferation and progression of NPC by targeting the MAPK/ERK and -catenin pathways. Oncol Lett. 2022 Jan;23(1):20. doi: 10.3892/ol.2021.13138. Epub 2021 Nov 16.