Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT91HOEP)

• DOT Name: Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 4 (NKAIN4)
• Synonyms: Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 4; Protein FAM77A
• Gene Name: NKAIN4
• Related Disease: Cardiovascular disease
• UniProt ID: NKAI4_HUMAN
• Pfam ID: PF05640
• Sequence:
  MGSCSGRCALVVLCAFQLVAALERQVFDFLGYQWAPILANFVHIIIVILGLFGTIQYRLR
  YVMVYTLWAAVWVTWNVFIICFYLEVGGLLKDSELLTFSLSRHRSWWRERWPGCLHEEVP
  AVGLGAPHGQALVSGAGCALEPSYVEALHSCLQILIALLGFVCGCQVVSVFTEEEDSFDF
  IGGFDPFPLYHVNEKPSSLLSKQVYLPA

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Cardiovascular disease	DIS2IQDX	Strong	Genetic Variation	[1]

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 4 (NKAIN4).	[2]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 4 (NKAIN4).	[3]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 4 (NKAIN4).	[4]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 4 (NKAIN4).	[6]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 4 (NKAIN4).	[7]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 4 (NKAIN4).	[5]

References

• [1] Genetic determinants of cardiovascular events among women with migraine: a genome-wide association study.PLoS One. 2011;6(7):e22106. doi: 10.1371/journal.pone.0022106. Epub 2011 Jul 14.
• [2] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [3] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [4] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [6] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [7] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.