Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT97EYB9)

• DOT Name: Calcium and integrin-binding family member 3 (CIB3)
• Synonyms: Kinase-interacting protein 3; KIP 3
• Gene Name: CIB3
• Related Disease:
  Classic Hodgkin lymphoma
  Plasma cell myeloma
  Small lymphocytic lymphoma
  Acute myelogenous leukaemia
• UniProt ID: CIB3_HUMAN
• PDB ID: 6WU5; 6WU7; 6WUD
• Pfam ID: PF13499
• Sequence:
  MGNKQTVFTHEQLEAYQDCTFFTRKEIMRLFYRYQDLAPQLVPLDYTTCPDVKVPYELIG
  SMPELKDNPFRQRIAQVFSEDGDGHMTLDNFLDMFSVMSEMAPRDLKAYYAFKIYDFNND
  DYICAWDLEQTVTKLTRGGLSAEEVSLVCEKVLDEADGDHDGRLSLEDFQNMILRAPDFL
  STFHIRI
• Function: Acts a an auxiliary subunit of the sensory mechanoelectrical transduction (MET) channel in hair cells. Plays a role in regulating hair cell MET channel localization and function.

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Classic Hodgkin lymphoma	DISV1LU6	Strong	Genetic Variation	[1]
Plasma cell myeloma	DIS0DFZ0	Strong	Genetic Variation	[1]
Small lymphocytic lymphoma	DIS30POX	Strong	Genetic Variation	[1]
Acute myelogenous leukaemia	DISCSPTN	Limited	Genetic Variation	[2]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Calcium and integrin-binding family member 3 (CIB3).	[3]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Calcium and integrin-binding family member 3 (CIB3).	[4]

References

• [1] Genome-wide association analysis of chronic lymphocytic leukaemia, Hodgkin lymphoma and multiple myeloma identifies pleiotropic risk loci.Sci Rep. 2017 Jan 23;7:41071. doi: 10.1038/srep41071.
• [2] Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
• [3] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [4] Comparison of transcriptome expression alterations by chronic exposure to low-dose bisphenol A in different subtypes of breast cancer cells. Toxicol Appl Pharmacol. 2019 Dec 15;385:114814. doi: 10.1016/j.taap.2019.114814. Epub 2019 Nov 9.