Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9F7AMT)

• DOT Name: Small EDRK-rich factor 1 (SERF1A)
• Synonyms: Protein 4F5; h4F5; SMA modifier 1
• Gene Name: SERF1A
• Related Disease:
  Obesity
  Spinal muscular atrophy
• UniProt ID: SERF1_HUMAN
• Pfam ID: PF04419
• Sequence:
  MARGNQRELARQKNMKKTQEISKGKRKEDSLTASQRKQSSGGQKSESKMSAGPHLPLKAP
  RENPCFPLPAAGGSRYYLAYGSITPISAFVFVVFFSVFFPSFYEDFCCWI
• Function: Positive regulator of amyloid protein aggregation and proteotoxicity. Induces conformational changes in amyloid proteins, such as APP, HTT, and SNCA, driving them into compact formations preceding the formation of aggregates.
• Tissue Specificity: Isoform Long is predominantly expressed in heart, brain and skeletal muscle. Isoform Short and Isoform Long are expressed throughout the central nervous system, including spinal cord.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Obesity	DIS47Y1K	Strong	Biomarker	[1]
Spinal muscular atrophy	DISTLKOB	Strong	Biomarker	[2]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Small EDRK-rich factor 1 (SERF1A).	[3]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Small EDRK-rich factor 1 (SERF1A).	[4]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Small EDRK-rich factor 1 (SERF1A).	[5]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Small EDRK-rich factor 1 (SERF1A).	[6]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Small EDRK-rich factor 1 (SERF1A).	[7]

References

• [1] Infectobesity: obesity of infectious origin.J Nutr. 2001 Oct;131(10):2794S-2797S. doi: 10.1093/jn/131.10.2794S.
• [2] Genotype-phenotype correlation of SMN locus genes in spinal muscular atrophy children from Argentina.Eur J Paediatr Neurol. 2016 Nov;20(6):910-917. doi: 10.1016/j.ejpn.2016.07.017. Epub 2016 Jul 28.
• [3] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [4] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [5] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [6] Targeting MYCN in neuroblastoma by BET bromodomain inhibition. Cancer Discov. 2013 Mar;3(3):308-23.
• [7] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.