| DOT Name |
Adapter molecule crk (CRK)
|
| Synonyms |
Proto-oncogene c-Crk; p38 |
| Gene Name |
CRK
|
| UniProt ID |
|
| 3D Structure |
|
| PDB ID |
1JU5 ; 2DVJ ; 2EYV ; 2EYW ; 2EYX ; 2EYY ; 2EYZ ; 2MS4 ; 5UL6 ; 6ATV |
| Pfam ID |
PF00017
; PF00018
; PF07653
|
| Sequence |
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHY
IINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSR
SRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG
MIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA
RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPD
EDFS
|
| Function |
Involved in cell branching and adhesion mediated by BCAR1-CRK-RAPGEF1 signaling and activation of RAP1; [Isoform Crk-II]: Regulates cell adhesion, spreading and migration. Mediates attachment-induced MAPK8 activation, membrane ruffling and cell motility in a Rac-dependent manner. Involved in phagocytosis of apoptotic cells and cell motility via its interaction with DOCK1 and DOCK4. May regulate the EFNA5-EPHA3 signaling.
|
| KEGG Pathway |
- MAPK sig.ling pathway (hsa04010 )
- ErbB sig.ling pathway (hsa04012 )
- Rap1 sig.ling pathway (hsa04015 )
- Chemokine sig.ling pathway (hsa04062 )
- Efferocytosis (hsa04148 )
- Focal adhesion (hsa04510 )
- Fc gamma R-mediated phagocytosis (hsa04666 )
- Neurotrophin sig.ling pathway (hsa04722 )
- Regulation of actin cytoskeleton (hsa04810 )
- Insulin sig.ling pathway (hsa04910 )
- Growth hormone synthesis, secretion and action (hsa04935 )
- Bacterial invasion of epithelial cells (hsa05100 )
- Shigellosis (hsa05131 )
- Yersinia infection (hsa05135 )
- Human cytomegalovirus infection (hsa05163 )
- Human immunodeficiency virus 1 infection (hsa05170 )
- Pathways in cancer (hsa05200 )
- MicroR.s in cancer (hsa05206 )
- Re.l cell carcinoma (hsa05211 )
- Chronic myeloid leukemia (hsa05220 )
|
| Reactome Pathway |
- Downstream signal transduction (R-HSA-186763 )
- Regulation of actin dynamics for phagocytic cup formation (R-HSA-2029482 )
- p130Cas linkage to MAPK signaling for integrins (R-HSA-372708 )
- VEGFA-VEGFR2 Pathway (R-HSA-4420097 )
- PTK6 Regulates RHO GTPases, RAS GTPase and MAP kinases (R-HSA-8849471 )
- MET activates RAP1 and RAC1 (R-HSA-8875555 )
- MET receptor recycling (R-HSA-8875656 )
- Regulation of signaling by CBL (R-HSA-912631 )
- FCGR3A-mediated phagocytosis (R-HSA-9664422 )
- ARMS-mediated activation (R-HSA-170984 )
|
|
|
|
|
|
|
