Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTA62UQB)

• DOT Name: Otoraplin (OTOR)
• Synonyms: Fibrocyte-derived protein; Melanoma inhibitory activity-like protein
• Gene Name: OTOR
• Related Disease:
  Melanoma
  Coagulation defect
  Disseminated intravascular coagulation
• UniProt ID: OTOR_HUMAN
• Pfam ID: PF07653
• Sequence:
  MARILLLFLPGLVAVCAVHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINV
  KKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPT
  TDIDFFCE
• Tissue Specificity: Highly expressed in cochlea.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Melanoma	DIS1RRCY	Definitive	Altered Expression	[1]
Coagulation defect	DIS9X3H6	Strong	Genetic Variation	[2]
Disseminated intravascular coagulation	DISCAVOZ	Strong	Altered Expression	[3]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Otoraplin (OTOR).	[4]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Otoraplin (OTOR).	[5]

References

• [1] The importance of melanoma inhibitory activity gene family in the tumor progression of oral cancer.Pathol Int. 2018 May;68(5):278-286. doi: 10.1111/pin.12672. Epub 2018 Apr 14.
• [2] Coagulation Disorders after Chimeric Antigen Receptor T Cell Therapy: Analysis of 100 Patients with Relapsed and Refractory Hematologic Malignancies.Biol Blood Marrow Transplant. 2020 May;26(5):865-875. doi: 10.1016/j.bbmt.2019.11.027. Epub 2019 Nov 28.
• [3] Role of Vascular Endothelial Cells in Disseminated Intravascular Coagulation Induced by Seawater Immersion in a Rat Trauma Model.Biomed Res Int. 2017;2017:5147532. doi: 10.1155/2017/5147532. Epub 2017 Jun 28.
• [4] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.