Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTAGQSQ6)

• DOT Name: Acidic leucine-rich nuclear phosphoprotein 32 family member D (ANP32D)
• Synonyms: Phosphoprotein 32-related protein 2; Tumorigenic protein pp32r2
• Gene Name: ANP32D
• Related Disease:
  Carcinoma
  Neoplasm
  Prostate adenocarcinoma
  Prostate cancer
  Prostate carcinoma
• UniProt ID: AN32D_HUMAN
• Pfam ID: PF14580
• Sequence:
  MEMGKWIHLELRNRTPSDVKELFLDNSQSNEGKLEGLTDEFEELELLNTINIGLTSIANL
  PKLNKLKKLELSSNRASVGLEVLAEKCPNLIHLNLSGNKIKDLSTIEPLKKLENLESLDL
  FTCEVTNLNNY

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Carcinoma	DISH9F1N	Strong	Biomarker	[1]
Neoplasm	DISZKGEW	Strong	Biomarker	[1]
Prostate adenocarcinoma	DISBZYU8	Strong	Altered Expression	[2]
Prostate cancer	DISF190Y	Strong	Biomarker	[3]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[3]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Acidic leucine-rich nuclear phosphoprotein 32 family member D (ANP32D).	[4]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Acidic leucine-rich nuclear phosphoprotein 32 family member D (ANP32D).	[5]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Acidic leucine-rich nuclear phosphoprotein 32 family member D (ANP32D).	[6]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Acidic leucine-rich nuclear phosphoprotein 32 family member D (ANP32D).	[7]

References

• [1] Expression of pp32 gene family members in breast cancer.Breast Cancer Res Treat. 2001 Jul;68(1):65-73. doi: 10.1023/a:1017919507109.
• [2] Tumor suppression and potentiation by manipulation of pp32 expression.Oncogene. 2001 Apr 19;20(17):2153-60. doi: 10.1038/sj.onc.1204294.
• [3] Modulation of oncogenic potential by alternative gene use in human prostate cancer.Nat Med. 1999 Mar;5(3):275-9. doi: 10.1038/6488.
• [4] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [5] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [6] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.