Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTAPN6SD)

• DOT Name: UPF0728 protein C10orf53 (C10ORF53)
• Gene Name: C10ORF53
• Related Disease:
  Acute myelogenous leukaemia
  Meningioma
  Primary angle-closure glaucoma
• UniProt ID: CJ053_HUMAN
• Pfam ID: PF15092
• Sequence:
  MPKNAVVILRYGPYSAAGLPVEHHTFRLQGLQAVLAIDGHEVILEKIEDWNVVELMVNEE
  VIFHCNIKDLEFGGDGKLDPLCEKARIAVLNAY

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute myelogenous leukaemia	DISCSPTN	Strong	Genetic Variation	[1]
Meningioma	DISPT4TG	moderate	Biomarker	[2]
Primary angle-closure glaucoma	DISX8UKZ	moderate	Genetic Variation	[3]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of UPF0728 protein C10orf53 (C10ORF53).	[4]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of UPF0728 protein C10orf53 (C10ORF53).	[7]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of UPF0728 protein C10orf53 (C10ORF53).	[5]
Malathion	DMXZ84M	Approved	Malathion decreases the expression of UPF0728 protein C10orf53 (C10ORF53).	[6]
Permethrin	DMZ0Q1G	Approved	Permethrin decreases the expression of UPF0728 protein C10orf53 (C10ORF53).	[6]

References

• [1] Identification of Novel Functional Variants of SIN3A and SRSF1 among Somatic Variants in Acute Myeloid Leukemia Patients.Mol Cells. 2018 May 31;41(5):465-475. doi: 10.14348/molcells.2018.0051. Epub 2018 May 15.
• [2] Whole exome sequencing in a case of sporadic multiple meningioma reveals shared NF2, FAM109B, and TPRXL mutations, together with unique SMARCB1 alterations in a subset of tumor nodules.Cancer Genet. 2015 Jun;208(6):327-32. doi: 10.1016/j.cancergen.2015.03.012. Epub 2015 Apr 11.
• [3] Genome-wide association study identifies five new susceptibility loci for primary angle closure glaucoma.Nat Genet. 2016 May;48(5):556-62. doi: 10.1038/ng.3540. Epub 2016 Apr 4.
• [4] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [5] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [6] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.