Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTB2YCND)

• DOT Name: CD2 antigen cytoplasmic tail-binding protein 2 (CD2BP2)
• Synonyms: CD2 cytoplasmic domain-binding protein 2; CD2 tail-binding protein 2; U5 snRNP 52K protein; U5-52K
• Gene Name: CD2BP2
• UniProt ID: CD2B2_HUMAN
• PDB ID: 1GYF; 1L2Z; 1SYX; 4BWS
• Pfam ID: PF02213
• Sequence:
  MPKRKVTFQGVGDEEDEDEIIVPKKKLVDPVAGSGGPGSRFKGKHSLDSDEEEDDDDGGS
  SKYDILASEDVEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNYFLNRDAQIRDSWL
  DNIDWVKIRERPPGQRQASDSEEEDSLGQTSMSAQALLEGLLELLLPRETVAGALRRLGA
  RGGGKGRKGPGQPSSPQRLDRLSGLADQMVARGNLGVYQETRERLAMRLKGLGCQTLGPH
  NPTPPPSLDMFAEELAEEELETPTPTQRGEAESRGDGLVDVMWEYKWENTGDAELYGPFT
  SAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT
• Function: Involved in pre-mRNA splicing as component of the U5 snRNP complex that is involved in spliceosome assembly.

Molecular Interaction Atlas (MIA) of This DOT

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of CD2 antigen cytoplasmic tail-binding protein 2 (CD2BP2).	[1]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of CD2 antigen cytoplasmic tail-binding protein 2 (CD2BP2).	[2]
Selenium	DM25CGV	Approved	Selenium increases the expression of CD2 antigen cytoplasmic tail-binding protein 2 (CD2BP2).	[3]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of CD2 antigen cytoplasmic tail-binding protein 2 (CD2BP2).	[3]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of CD2 antigen cytoplasmic tail-binding protein 2 (CD2BP2).	[5]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of CD2 antigen cytoplasmic tail-binding protein 2 (CD2BP2).	[7]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of CD2 antigen cytoplasmic tail-binding protein 2 (CD2BP2).	[4]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of CD2 antigen cytoplasmic tail-binding protein 2 (CD2BP2).	[6]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [3] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [6] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [7] Ochratoxin a lowers mRNA levels of genes encoding for key proteins of liver cell metabolism. Cancer Genomics Proteomics. 2008 Nov-Dec;5(6):319-32.