| DOT Name |
Charged multivesicular body protein 4a (CHMP4A)
|
| Synonyms |
Chromatin-modifying protein 4a; CHMP4a; SNF7 homolog associated with Alix-2; SNF7-1; hSnf-1; Vacuolar protein sorting-associated protein 32-1; Vps32-1; hVps32-1 |
| Gene Name |
CHMP4A
|
| Related Disease |
- Fragile X syndrome ( )
- Myopia ( )
|
| UniProt ID |
|
| 3D Structure |
|
| PDB ID |
|
| Pfam ID |
|
| Sequence |
MSGLGRLFGKGKKEKGPTPEEAIQKLKETEKILIKKQEFLEQKIQQELQTAKKYGTKNKR
AALQALRRKKRFEQQLAQTDGTLSTLEFQREAIENATTNAEVLRTMELAAQSMKKAYQDM
DIDKVDELMTDITEQQEVAQQISDAISRPMGFGDDVDEDELLEELEELEQEELAQELLNV
GDKEEEPSVKLPSVPSTHLPAGPAPKVDEDEEALKQLAEWVS
|
| Function |
Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses). ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. When overexpressed, membrane-assembled circular arrays of CHMP4A filaments can promote or stabilize negative curvature and outward budding. Via its interaction with PDCD6IP involved in HIV-1 p6- and p9-dependent virus release. CHMP4A/B/C are required for the exosomal release of SDCBP, CD63 and syndecan.
|
| Tissue Specificity |
Widely expressed. Expressed at higher level in heart, kidney, liver and skeletal muscle. Also expressed in brain, placenta, lung and pancreas. |
| KEGG Pathway |
- Viral life cycle - HIV-1 (hsa03250 )
- Endocytosis (hsa04144 )
- Necroptosis (hsa04217 )
|
| Reactome Pathway |
- Macroautophagy (R-HSA-1632852 )
- Pyroptosis (R-HSA-5620971 )
- Endosomal Sorting Complex Required For Transport (ESCRT) (R-HSA-917729 )
- HCMV Late Events (R-HSA-9610379 )
- Late endosomal microautophagy (R-HSA-9615710 )
- Sealing of the nuclear envelope (NE) by ESCRT-III (R-HSA-9668328 )
- Translation of Replicase and Assembly of the Replication Transcription Complex (R-HSA-9679504 )
- Translation of Replicase and Assembly of the Replication Transcription Complex (R-HSA-9694676 )
- Budding and maturation of HIV virion (R-HSA-162588 )
|
|
|
|
|
|
|
