Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBX291E)

• DOT Name: Synaptophysin-like protein 1 (SYPL1)
• Synonyms: Pantophysin
• Gene Name: SYPL1
• Related Disease:
  Thyroid gland papillary carcinoma
  Hepatocellular carcinoma
• UniProt ID: SYPL1_HUMAN
• Pfam ID: PF01284
• Sequence:
  MAPNIYLVRQRISRLGQRMSGFQINLNPLKEPLGFIKVLEWIASIFAFATCGGFKGQTEI
  QVNCPPAVTENKTVTATFGYPFRLNEASFQPPPGVNICDVNWKDYVLIGDYSSSAQFYVT
  FAVFVFLYCIAALLLYVGYTSLYLDSRKLPMIDFVVTLVATFLWLVSTSAWAKALTDIKI
  ATGHNIIDELPPCKKKAVLCYFGSVTSMGSLNVSVIFGFLNMILWGGNAWFVYKETSLHS
  PSNTSAPHSQGGIPPPTGI

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Thyroid gland papillary carcinoma	DIS48YMM	Definitive	Biomarker	[1]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[2]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Synaptophysin-like protein 1 (SYPL1).	[3]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Synaptophysin-like protein 1 (SYPL1).	[6]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Synaptophysin-like protein 1 (SYPL1).	[8]

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Synaptophysin-like protein 1 (SYPL1).	[4]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Synaptophysin-like protein 1 (SYPL1).	[5]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Synaptophysin-like protein 1 (SYPL1).	[7]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Synaptophysin-like protein 1 (SYPL1).	[9]
GALLICACID	DM6Y3A0	Investigative	GALLICACID decreases the expression of Synaptophysin-like protein 1 (SYPL1).	[10]

References

• [1] Identification of differentiated functional modules in papillary thyroid carcinoma by analyzing differential networks.J Cancer Res Ther. 2018 Dec;14(Supplement):S969-S974. doi: 10.4103/jcrt.JCRT_730_16.
• [2] SYPL1 overexpression predicts poor prognosis of hepatocellular carcinoma and associates with epithelial-mesenchymal transition.Oncol Rep. 2017 Sep;38(3):1533-1542. doi: 10.3892/or.2017.5843. Epub 2017 Jul 21.
• [3] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [4] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [5] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [6] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [7] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [9] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [10] Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.