Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTC5JAVO)

DOT Name Probable threonine protease PRSS50 (PRSS50)
Synonyms EC 3.4.25.-; Cancer/testis antigen 20; Serine protease 50; Testis-specific protease-like protein 50
Gene Name PRSS50
Related Disease
Breast cancer ( )
Breast carcinoma ( )
Breast neoplasm ( )
Cervical cancer ( )
Cervical carcinoma ( )
Depression ( )
Uterine cervix neoplasm ( )
Advanced cancer ( )
Age-related macular degeneration ( )
Colorectal adenoma ( )
Colorectal carcinoma ( )
Gastric cancer ( )
Neoplasm ( )
Non-small-cell lung cancer ( )
Stomach cancer ( )
UniProt ID
TSP50_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
3.4.25.-
Pfam ID
PF00089
Sequence
MGRWCQTVARGQRPRTSAPSRAGALLLLLLLLRSAGCWGAGEAPGALSTADPADQSVQCV
PKATCPSSRPRLLWQTPTTQTLPSTTMETQFPVSEGKVDPYRSCGFSYEQDPTLRDPEAV
ARRWPWMVSVRANGTHICAGTIIASQWVLTVAHCLIWRDVIYSVRVGSPWIDQMTQTASD
VPVLQVIMHSRYRAQRFWSWVGQANDIGLLKLKQELKYSNYVRPICLPGTDYVLKDHSRC
TVTGWGLSKADGMWPQFRTIQEKEVIILNNKECDNFYHNFTKIPTLVQIIKSQMMCAEDT
HREKFCYELTGEPLVCSMEGTWYLVGLVSWGAGCQKSEAPPIYLQVSSYQHWIWDCLNGQ
ALALPAPSRTLLLALPLPLSLLAAL
Function May be involved in proteolysis through its threonine endopeptidase activity.
Tissue Specificity Testis specific. Differentially expressed in some breast cancer tissues.

Molecular Interaction Atlas (MIA) of This DOT

15 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Breast cancer DIS7DPX1 Strong Altered Expression [1]
Breast carcinoma DIS2UE88 Strong Altered Expression [1]
Breast neoplasm DISNGJLM Strong Altered Expression [2]
Cervical cancer DISFSHPF Strong Altered Expression [3]
Cervical carcinoma DIST4S00 Strong Altered Expression [3]
Depression DIS3XJ69 Strong Biomarker [4]
Uterine cervix neoplasm DIS0BYVV Strong Genetic Variation [3]
Advanced cancer DISAT1Z9 moderate Altered Expression [5]
Age-related macular degeneration DIS0XS2C moderate Genetic Variation [6]
Colorectal adenoma DISTSVHM Limited Altered Expression [7]
Colorectal carcinoma DIS5PYL0 Limited Altered Expression [1]
Gastric cancer DISXGOUK Limited Biomarker [8]
Neoplasm DISZKGEW Limited Altered Expression [1]
Non-small-cell lung cancer DIS5Y6R9 Limited Altered Expression [1]
Stomach cancer DISKIJSX Limited Biomarker [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 15 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Probable threonine protease PRSS50 (PRSS50). [9]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Probable threonine protease PRSS50 (PRSS50). [10]
------------------------------------------------------------------------------------

References

1 Testes-specific protease 50 as an independent risk factor for poor prognosis in patients with non-small cell lung cancer.Oncol Lett. 2018 Jun;15(6):8796-8804. doi: 10.3892/ol.2018.8387. Epub 2018 Mar 29.
2 TSP50, a possible protease in human testes, is activated in breast cancer epithelial cells.Cancer Res. 2002 Jan 1;62(1):290-4.
3 TSP50 depends on its threonine protease activity and its interactions with TNF--induced NF-B for its role in human cervical tumorigenesis.Cell Biochem Biophys. 2015 Mar;71(2):891-6. doi: 10.1007/s12013-014-0279-8.
4 Depression of testes-specific protease 50 (TSP50) inhibits cell proliferation and induces apoptosis in laryngocarcinoma.Tumour Biol. 2014 Nov;35(11):10781-8. doi: 10.1007/s13277-014-2090-y. Epub 2014 Jul 31.
5 25-methoxyl-dammarane-3, 12, 20-triol and artemisinin synergistically inhibit MDA-MB-231 cell proliferation through downregulation of testes-specific protease 50 (TSP50) expression.Tumour Biol. 2016 Sep;37(9):11805-11813. doi: 10.1007/s13277-016-5037-7. Epub 2016 Apr 2.
6 Differential DNA methylation identified in the blood and retina of AMD patients.Epigenetics. 2015;10(8):698-707. doi: 10.1080/15592294.2015.1060388.
7 High expression of testes-specific protease 50 is associated with poor prognosis in colorectal carcinoma.PLoS One. 2011;6(7):e22203. doi: 10.1371/journal.pone.0022203. Epub 2011 Jul 12.
8 Testes-specific protease 50 (TSP50) promotes invasion and metastasis by inducing EMT in gastric cancer.BMC Cancer. 2018 Jan 23;18(1):94. doi: 10.1186/s12885-018-4000-y.
9 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
10 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.