Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTC7R3YL)

DOT Name	MORN repeat-containing protein 5 (MORN5)
Gene Name	MORN5
Related Disease	Lung squamous cell carcinoma ( ) Isolated cleft palate ( )
UniProt ID	MORN5_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF02493
Sequence	MEYTGSKYIGEYVDGRMEGKAKYILPTETIYVGEMKDGMFHGEGTLYFPSGSQYDAIWEN GLAIKGTYTFSDGLHYDEKNWHYCDGYDRRFYTEILNGLKPAGMAQLTNMDPPRKIPKGY YDCGDGFYNPVTRVVKDYRNRFLRNADDDEHEWITRTCRKG
Tissue Specificity	Expressed in sperm (at protein level).

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Lung squamous cell carcinoma	DISXPIBD	Strong	Genetic Variation	[1]
Isolated cleft palate	DISV80CD	No Known	Unknown	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of MORN repeat-containing protein 5 (MORN5).	[3]
------------------------------------------------------------------------------------

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of MORN repeat-containing protein 5 (MORN5).	[4]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of MORN repeat-containing protein 5 (MORN5).	[4]
Fenfluramine	DM0762O	Phase 3	Fenfluramine increases the expression of MORN repeat-containing protein 5 (MORN5).	[5]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of MORN repeat-containing protein 5 (MORN5).	[6]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of MORN repeat-containing protein 5 (MORN5).	[7]
------------------------------------------------------------------------------------

References

1	Identification of risk loci and a polygenic risk score for lung cancer: a large-scale prospective cohort study in Chinese populations.Lancet Respir Med. 2019 Oct;7(10):881-891. doi: 10.1016/S2213-2600(19)30144-4. Epub 2019 Jul 17.
2	MORN5 Expression during Craniofacial Development and Its Interaction with the BMP and TGF Pathways. Front Physiol. 2016 Aug 31;7:378. doi: 10.3389/fphys.2016.00378. eCollection 2016.
3	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4	Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
5	Fenfluramine-induced gene dysregulation in human pulmonary artery smooth muscle and endothelial cells. Pulm Circ. 2011 Jul-Sep;1(3):405-18. doi: 10.4103/2045-8932.87310.
6	Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
7	Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.