Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTCY4KST)

• DOT Name: Ras association domain-containing protein 9 (RASSF9)
• Synonyms: PAM COOH-terminal interactor protein 1; P-CIP1; Peptidylglycine alpha-amidating monooxygenase COOH-terminal interactor
• Gene Name: RASSF9
• Related Disease:
  Gastric cancer
  Stomach cancer
  Breast cancer
  Breast carcinoma
• UniProt ID: RASF9_HUMAN
• Sequence:
  MAPFGRNLLKTRHKNRSPTKDMDSEEKEIVVWVCQEEKLVCGLTKRTTSADVIQALLEEH
  EATFGEKRFLLGKPSDYCIIEKWRGSERVLPPLTRILKLWKAWGDEQPNMQFVLVKADAF
  LPVPLWRTAEAKLVQNTEKLWELSPANYMKTLPPDKQKRIVRKTFRKLAKIKQDTVSHDR
  DNMETLVHLIISQDHTIHQQVKRMKELDLEIEKCEAKFHLDRVENDGENYVQDAYLMPSF
  SEVEQNLDLQYEENQTLEDLSESDGIEQLEERLKYYRILIDKLSAEIEKEVKSVCIDINE
  DAEGEAASELESSNLESVKCDLEKSMKAGLKIHSHLSGIQKEIKYSDSLLQMKAKEYELL
  AKEFNSLHISNKDGCQLKENRAKESEVPSSNGEIPPFTQRVFSNYTNDTDSDTGISSNHS
  QDSETTVGDVVLLST
• Function: May play a role in regulating vesicuar trafficking in cells.

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Gastric cancer	DISXGOUK	Definitive	Altered Expression	[1]
Stomach cancer	DISKIJSX	Definitive	Altered Expression	[1]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[2]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[2]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Ras association domain-containing protein 9 (RASSF9).	[3]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Ras association domain-containing protein 9 (RASSF9).	[4]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Ras association domain-containing protein 9 (RASSF9).	[6]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Ras association domain-containing protein 9 (RASSF9).	[7]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Ras association domain-containing protein 9 (RASSF9).	[8]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Ras association domain-containing protein 9 (RASSF9).	[9]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Ras association domain-containing protein 9 (RASSF9).	[5]

References

• [1] MicroRNA-1269 promotes cell proliferation via the AKT signaling pathway by targeting RASSF9 in human gastric cancer.Cancer Cell Int. 2019 Nov 21;19:308. doi: 10.1186/s12935-019-1026-4. eCollection 2019.
• [2] MicroRNA-1254 exertsoncogenic effects by directly targeting RASSF9 in human breast cancer.Int J Oncol. 2018 Nov;53(5):2145-2156. doi: 10.3892/ijo.2018.4530. Epub 2018 Aug 21.
• [3] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [4] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [6] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [7] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [8] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
• [9] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.