Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTDGZKED)

• DOT Name: P2Y purinoceptor 14 (P2RY14)
• Synonyms: P2Y14; G-protein coupled receptor 105; UDP-glucose receptor
• Gene Name: P2RY14
• UniProt ID: P2Y14_HUMAN
• Pfam ID: PF00001
• Sequence:
  MINSTSTQPPDESCSQNLLITQQIIPVLYCMVFIAGILLNGVSGWIFFYVPSSKSFIIYL
  KNIVIADFVMSLTFPFKILGDSGLGPWQLNVFVCRVSAVLFYVNMYVSIVFFGLISFDRY
  YKIVKPLWTSFIQSVSYSKLLSVIVWMLMLLLAVPNIILTNQSVREVTQIKCIELKSELG
  RKWHKASNYIFVAIFWIVFLLLIVFYTAITKKIFKSHLKSSRNSTSVKKKSSRNIFSIVF
  VFFVCFVPYHIARIPYTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQ
  PFREILCKKLHIPLKAQNDLDISRIKRGNTTLESTDTL
• Function: Receptor for UDP-glucose and other UDP-sugar coupled to G-proteins. Not activated by ATP, ADP, UTP or ATP.
• Tissue Specificity: Highest expression in the placenta, adipose tissue, stomach and intestine, intermediate levels in the brain, spleen, lung and heart, lowest levels in the kidney.
• KEGG Pathway: Neuroactive ligand-receptor interaction (hsa04080)
• Reactome Pathway:
  G alpha (i) signalling events (R-HSA-418594)
  P2Y receptors (R-HSA-417957)

Molecular Interaction Atlas (MIA) of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of P2Y purinoceptor 14 (P2RY14).	[1]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of P2Y purinoceptor 14 (P2RY14).	[2]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of P2Y purinoceptor 14 (P2RY14).	[3]
Mifepristone	DMGZQEF	Approved	Mifepristone increases the expression of P2Y purinoceptor 14 (P2RY14).	[4]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene increases the expression of P2Y purinoceptor 14 (P2RY14).	[2]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [3] Progesterone regulation of implantation-related genes: new insights into the role of oestrogen. Cell Mol Life Sci. 2007 Apr;64(7-8):1009-32.
• [4] Mifepristone induced progesterone withdrawal reveals novel regulatory pathways in human endometrium. Mol Hum Reprod. 2007 Sep;13(9):641-54.