Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTDI4B55)

• DOT Name: Cysteine-rich secretory protein 1 (CRISP1)
• Synonyms: CRISP-1; AEG-like protein; ARP; Acidic epididymal glycoprotein homolog
• Gene Name: CRISP1
• Related Disease:
  Carcinoma of esophagus
  Esophageal cancer
  Esophageal squamous cell carcinoma
  Neoplasm of esophagus
  Pancreatic cancer
  Pancreatitis
  Syphilis
• UniProt ID: CRIS1_HUMAN
• Pfam ID: PF00188 ; PF08562
• Sequence:
  MEIKHLLFLVAAACLLPMLSMKKKSARDQFNKLVTDLPNVQEEIVNIHNALRRRVVPPAS
  NMLKMSWSEEAAQNARIFSKYCDMTESNPLERRLPNTFCGENMHMTSYPVSWSSVIGVWY
  SESTSFKHGEWTTTDDDITTDHYTQIVWATSYLIGCAIASCRQQGSPRYLYVCHYCHEGN
  DPETKNEPYKTGVPCEACPSNCEDKLCTNPCIYYDEYFDCDIQVHYLGCNHSTTILFCKA
  TCLCDTEIK
• Function: May have a role in sperm-egg fusion and maturation.
• Tissue Specificity: Caput, corpus, and cauda regions of the epididymis, the ductus deferens, sperm and seminal plasma.

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Carcinoma of esophagus	DISS6G4D	Strong	Genetic Variation	[1]
Esophageal cancer	DISGB2VN	Strong	Genetic Variation	[1]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Genetic Variation	[1]
Neoplasm of esophagus	DISOLKAQ	Strong	Genetic Variation	[1]
Pancreatic cancer	DISJC981	Strong	Genetic Variation	[2]
Pancreatitis	DIS0IJEF	Strong	Biomarker	[3]
Syphilis	DISJ73BS	Limited	Genetic Variation	[4]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Cysteine-rich secretory protein 1 (CRISP1).	[5]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Calphostin C	DM9X2D0	Terminated	Calphostin C affects the expression of Cysteine-rich secretory protein 1 (CRISP1).	[6]
QUERCITRIN	DM1DH96	Investigative	QUERCITRIN decreases the expression of Cysteine-rich secretory protein 1 (CRISP1).	[7]

References

• [1] Polymorphic variation of the ARP gene on 3p21 in Japanese esophageal cancer patients.Oncol Rep. 2000 May-Jun;7(3):591-3. doi: 10.3892/or.7.3.591.
• [2] Lack of association between UGT1A7, UGT1A9, ARP, SPINK1 and CFTR gene polymorphisms and pancreatic cancer in Italian patients.World J Gastroenterol. 2006 Oct 21;12(39):6343-8. doi: 10.3748/wjg.v12.i39.6343.
• [3] An Evaluation of Factors Associated With Pathogenic PRSS1, SPINK1, CTFR, and/or CTRC Genetic Variants in Patients With Idiopathic Pancreatitis.Am J Gastroenterol. 2017 Aug;112(8):1320-1329. doi: 10.1038/ajg.2017.106. Epub 2017 Apr 25.
• [4] Multicentre surveillance of prevalence of the 23S rRNA A2058G and A2059G point mutations and molecular subtypes of Treponema pallidum in Taiwan, 2009-2013.Clin Microbiol Infect. 2014 Aug;20(8):802-7. doi: 10.1111/1469-0691.12529. Epub 2014 Feb 13.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [6] Targeting the beta-catenin/TCF transcriptional complex in the treatment of multiple myeloma. Proc Natl Acad Sci U S A. 2007 May 1;104(18):7516-21. doi: 10.1073/pnas.0610299104. Epub 2007 Apr 23.
• [7] Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.