Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTDNAKQD)

• DOT Name: Protein eva-1 homolog B (EVA1B)
• Synonyms: Protein FAM176B
• Gene Name: EVA1B
• UniProt ID: EVA1B_HUMAN
• Pfam ID: PF14851
• Sequence:
  MDAPRRDMELLSNSLAAYAHIRANPESFGLYFVLGVCFGLLLTLCLLVISISWAPRPRPR
  GPAQRRDPRSSTLEPEDDDEDEEDTVTRLGPDDTLPGPELSAEPDGPLNVNVFTSAEELE
  RAQRLEERERILREIWRTGQPDLLGTGTLGPSPTATGTLGRMHYY

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Topotecan	DMP6G8T	Approved	Protein eva-1 homolog B (EVA1B) affects the response to substance of Topotecan.	[13]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Protein eva-1 homolog B (EVA1B).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Protein eva-1 homolog B (EVA1B).	[10]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Protein eva-1 homolog B (EVA1B).	[11]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Protein eva-1 homolog B (EVA1B).	[12]

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Protein eva-1 homolog B (EVA1B).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Protein eva-1 homolog B (EVA1B).	[3]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Protein eva-1 homolog B (EVA1B).	[4]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Protein eva-1 homolog B (EVA1B).	[5]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Protein eva-1 homolog B (EVA1B).	[6]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Protein eva-1 homolog B (EVA1B).	[6]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Protein eva-1 homolog B (EVA1B).	[7]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Protein eva-1 homolog B (EVA1B).	[8]
APR-246	DMNFADH	Phase 2	APR-246 affects the expression of Protein eva-1 homolog B (EVA1B).	[9]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [5] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [6] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [7] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [8] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [9] Mutant p53 reactivation by PRIMA-1MET induces multiple signaling pathways converging on apoptosis. Oncogene. 2010 Mar 4;29(9):1329-38. doi: 10.1038/onc.2009.425. Epub 2009 Nov 30.
• [10] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [11] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [12] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [13] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.