Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTDRYXSD)

• DOT Name: PHD finger protein 7 (PHF7)
• Synonyms: Testis development protein NYD-SP6
• Gene Name: PHF7
• Related Disease:
  Advanced cancer
  Male infertility
  Bipolar disorder
• UniProt ID: PHF7_HUMAN
• Pfam ID: PF13771
• Sequence:
  MKTVKEKKECQRLRKSAKTRRVTQRKPSSGPVCWLCLREPGDPEKLGEFLQKDNISVHYF
  CLILSSKLPQRGQSNRGFHGFLPEDIKKEAARASRKICFVCKKKGAAINCQKDQCLRNFH
  LPCGQERGCLSQFFGEYKSFCDKHRPTQNIQHGHVGEESCILCCEDLSQQSVENIQSPCC
  SQAIYHRKCIQKYAHTSAKHFFKCPQCNNRKEFPQEMLRMGIHIPDRDAAWELEPGAFSD
  LYQRYQHCDAPICLYEQGRDSFEDEGRWCLILCATCGSHGTHRDCSSLRSNSKKWECEEC
  SPAAATDYIPENSGDIPCCSSTFHPEEHFCRDNTLEENPGLSWTDWPEPSLLEKPESSRG
  RRSYSWRSKGVRITNSCKKSK
• Function: May play a role in spermatogenesis.
• Tissue Specificity: Highly expressed in Sertoli cells, but not in germ cells in adult testis. Expression in embryonic testis is 30-times lower. Highly expressed in colon, spleen, white blood cells, pancreas, lung, liver, placenta and brain. Detected at lower levels in thymus, small intestine, ovary and kidney.

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[1]
Male infertility	DISY3YZZ	Strong	Genetic Variation	[2]
Bipolar disorder	DISAM7J2	moderate	Genetic Variation	[3]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of PHD finger protein 7 (PHF7).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of PHD finger protein 7 (PHF7).	[5]

References

• [1] The histone code reader PHD finger protein 7 controls sex-linked disparities in gene expression and malignancy in Drosophila.Sci Adv. 2019 Aug 14;5(8):eaaw7965. doi: 10.1126/sciadv.aaw7965. eCollection 2019 Aug.
• [2] PHF7 is a novel histone H2A E3 ligase prior to histone-to-protamine exchange during spermiogenesis.Development. 2019 Jul 10;146(13):dev175547. doi: 10.1242/dev.175547.
• [3] Genome-wide association study meta-analysis of European and Asian-ancestry samples identifies three novel loci associated with bipolar disorder.Mol Psychiatry. 2013 Feb;18(2):195-205. doi: 10.1038/mp.2011.157. Epub 2011 Dec 20.
• [4] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [5] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.