Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFGSCHQ)

• DOT Name: Secretory carrier-associated membrane protein 2 (SCAMP2)
• Synonyms: Secretory carrier membrane protein 2
• Gene Name: SCAMP2
• Related Disease:
  Breast carcinoma
  Idiopathic thrombocytopenic purpura
• UniProt ID: SCAM2_HUMAN
• Pfam ID: PF04144
• Sequence:
  MSAFDTNPFADPVDVNPFQDPSVTQLTNAPQGGLAEFNPFSETNAATTVPVTQLPGSSQP
  AVLQPSVEPTQPTPQAVVSAAQAGLLRQQEELDRKAAELERKERELQNTVANLHVRQNNW
  PPLPSWCPVKPCFYQDFSTEIPADYQRICKMLYYLWMLHSVTLFLNLLACLAWFSGNSSK
  GVDFGLSILWFLIFTPCAFLCWYRPIYKAFRSDNSFSFFVFFFVFFCQIGIYIIQLVGIP
  GLGDSGWIAALSTLDNHSLAISVIMMVVAGFFTLCAVLSVFLLQRVHSLYRRTGASFQQA
  QEEFSQGIFSSRTFHRAASSAAQGAFQGN
• Function: Functions in post-Golgi recycling pathways. Acts as a recycling carrier to the cell surface.
• Tissue Specificity: Widely expressed.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Breast carcinoma	DIS2UE88	Strong	Genetic Variation	[1]
Idiopathic thrombocytopenic purpura	DISFKGJU	Strong	Biomarker	[2]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Secretory carrier-associated membrane protein 2 (SCAMP2).	[3]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Secretory carrier-associated membrane protein 2 (SCAMP2).	[8]

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Secretory carrier-associated membrane protein 2 (SCAMP2).	[4]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Secretory carrier-associated membrane protein 2 (SCAMP2).	[5]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Secretory carrier-associated membrane protein 2 (SCAMP2).	[6]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Secretory carrier-associated membrane protein 2 (SCAMP2).	[7]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Secretory carrier-associated membrane protein 2 (SCAMP2).	[9]

References

• [1] Association analysis identifies 65 new breast cancer risk loci.Nature. 2017 Nov 2;551(7678):92-94. doi: 10.1038/nature24284. Epub 2017 Oct 23.
• [2] Increasing observation rates in low-risk pediatric immune thrombocytopenia using a standardized clinical assessment and management plan (SCAMP() ).Pediatr Blood Cancer. 2017 May;64(5):10.1002/pbc.26303. doi: 10.1002/pbc.26303. Epub 2016 Oct 26.
• [3] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [4] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [5] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [6] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [7] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [8] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [9] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.