Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFQ0E2X)

• DOT Name: Forkhead box protein I2 (FOXI2)
• Gene Name: FOXI2
• Related Disease:
  Oral cancer
  Retinitis pigmentosa
• UniProt ID: FOXI2_HUMAN
• Pfam ID: PF00250
• Sequence:
  MATYCDDLGPSSAPPGQAQATAHPPGYEPGDLGAVGGGPLLWVNAPALSPKSYASGPGPA
  PPYAAPSYGAPGPLLGAPGGLAGADLAWLSLSGQQELLRLVRPPYSYSALIAMAIQSAPL
  RKLTLSQIYQYVAGNFPFYKRSKAGWQNSIRHNLSLNDCFKKVPRDEDDPGKGNYWTLDP
  NCEKMFDNGNFRRKRKRRAEASAAVRSGARSVGGAEAPALEPPSAACLDLQASPSPSAPE
  AATCFSGFASAMSALAGGLGTFPGGLAGDFSFGRRPPTVATHAPQTLNPSPGFAPGHQTA
  AAGFRLSHLLYSREGTEV
• Function: Possible transcriptional activator.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Oral cancer	DISLD42D	Strong	Posttranslational Modification	[1]
Retinitis pigmentosa	DISCGPY8	moderate	Biomarker	[2]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Forkhead box protein I2 (FOXI2).	[3]
Estradiol	DMUNTE3	Approved	Estradiol affects the expression of Forkhead box protein I2 (FOXI2).	[4]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Forkhead box protein I2 (FOXI2).	[3]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Forkhead box protein I2 (FOXI2).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Forkhead box protein I2 (FOXI2).	[6]

References

• [1] New DNA methylation markers and global DNA hypomethylation are associated with oral cancer development.Cancer Prev Res (Phila). 2015 Nov;8(11):1027-35. doi: 10.1158/1940-6207.CAPR-14-0179. Epub 2015 Sep 4.
• [2] Comprehensive Rare Variant Analysis via Whole-Genome Sequencing to Determine the Molecular Pathology of Inherited Retinal Disease.Am J Hum Genet. 2017 Jan 5;100(1):75-90. doi: 10.1016/j.ajhg.2016.12.003. Epub 2016 Dec 29.
• [3] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [4] Identification of novel low-dose bisphenol a targets in human foreskin fibroblast cells derived from hypospadias patients. PLoS One. 2012;7(5):e36711. doi: 10.1371/journal.pone.0036711. Epub 2012 May 4.
• [5] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.