| DOT Name |
V-type proton ATPase subunit e 2 (ATP6V0E2)
|
| Synonyms |
V-ATPase subunit e 2; Lysosomal 9 kDa H(+)-transporting ATPase V0 subunit e2; Vacuolar proton pump subunit e 2 |
| Gene Name |
ATP6V0E2
|
| UniProt ID |
|
| 3D Structure |
|
| Pfam ID |
|
| Sequence |
MTAHSFALPVIIFTTFWGLVGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQL
NPLFGPQLKNETIWYVRFLWE
|
| Function |
Subunit of the V0 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments and in some cell types, is targeted to the plasma membrane, where it is responsible for acidifying the extracellular environment.
|
| Tissue Specificity |
Isoform 1 is expressed at high levels in heart, brain and kidney and also detected in inner ear epithelium, vestibule, testis, epididymis and bladder. Isoform 2 is expressed in heart, kidney, placenta and pancreas. Isoform 2 is not detected in frontal cortex, but is prevalent in all other brain areas.
|
| KEGG Pathway |
- Oxidative phosphorylation (hsa00190 )
- Metabolic pathways (hsa01100 )
- Phagosome (hsa04145 )
- Sy.ptic vesicle cycle (hsa04721 )
- Collecting duct acid secretion (hsa04966 )
- Vibrio cholerae infection (hsa05110 )
- Epithelial cell sig.ling in Helicobacter pylori infection (hsa05120 )
- Human papillomavirus infection (hsa05165 )
- Rheumatoid arthritis (hsa05323 )
|
| Reactome Pathway |
- Insulin receptor recycling (R-HSA-77387 )
- Transferrin endocytosis and recycling (R-HSA-917977 )
- Amino acids regulate mTORC1 (R-HSA-9639288 )
- Ion channel transport (R-HSA-983712 )
- ROS and RNS production in phagocytes (R-HSA-1222556 )
|
| BioCyc Pathway |
-
- MetaCyc:HS15951-MONOMER
|
|
|
|
|
|
|
