Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTG1GL9H)

• DOT Name: Low-density lipoprotein receptor class A domain-containing protein 1 (LDLRAD1)
• Gene Name: LDLRAD1
• Related Disease:
  Breast cancer
  Prostate cancer
  Prostate carcinoma
• UniProt ID: LRAD1_HUMAN
• Pfam ID: PF00057
• Sequence:
  MNKVFPQGENGYTAAESKAHPGGEAGGGHLCCSRRGACLSASLLLLLATVAALIALVTIL
  GLPSCTPGAQACITLTNRTGFLCHDQRSCIPASGVCDGVRTCTHGEDEDESLCRDVPQSL
  PHFLVAHCGDPASWIYSDQKCDGTNNCGDCSDELSPVTVCPPCGPGWWRCPSTFFKYCDC
  IPRHLCRDHVQHCSDWSDEYACPGP

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Breast cancer	DIS7DPX1	Strong	Genetic Variation	[1]
Prostate cancer	DISF190Y	Strong	Genetic Variation	[1]
Prostate carcinoma	DISMJPLE	Strong	Genetic Variation	[1]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Low-density lipoprotein receptor class A domain-containing protein 1 (LDLRAD1).	[2]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Low-density lipoprotein receptor class A domain-containing protein 1 (LDLRAD1).	[3]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Low-density lipoprotein receptor class A domain-containing protein 1 (LDLRAD1).	[4]
OTX-015	DMI8RG1	Phase 1/2	OTX-015 decreases the expression of Low-density lipoprotein receptor class A domain-containing protein 1 (LDLRAD1).	[5]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Low-density lipoprotein receptor class A domain-containing protein 1 (LDLRAD1).	[6]

References

• [1] Genome-wide testing of putative functional exonic variants in relationship with breast and prostate cancer risk in a multiethnic population.PLoS Genet. 2013 Mar;9(3):e1003419. doi: 10.1371/journal.pgen.1003419. Epub 2013 Mar 28.
• [2] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [3] Endoplasmic reticulum stress contributes to arsenic trioxide-induced intrinsic apoptosis in human umbilical and bone marrow mesenchymal stem cells. Environ Toxicol. 2016 Mar;31(3):314-28.
• [4] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [5] Comprehensive transcriptome profiling of BET inhibitor-treated HepG2 cells. PLoS One. 2022 Apr 29;17(4):e0266966. doi: 10.1371/journal.pone.0266966. eCollection 2022.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.