Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTG6BFLI)

• DOT Name: NudC domain-containing protein 2 (NUDCD2)
• Gene Name: NUDCD2
• UniProt ID: NUDC2_HUMAN
• Pfam ID: PF04969
• Sequence:
  MSAPFEERSGVVPCGTPWGQWYQTLEEVFIEVQVPPGTRAQDIQCGLQSRHVALSVGGRE
  ILKGKLFDSTIADEGTWTLEDRKMVRIVLTKTKRDAANCWTSLLESEYAADPWVQDQMQR
  KLTLERFQKENPGFDFSGAEISGNYTKGGPDFSNLEK
• Function: May regulate the LIS1/dynein pathway by stabilizing LIS1 with Hsp90 chaperone.

Molecular Interaction Atlas (MIA) of This DOT

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of NudC domain-containing protein 2 (NUDCD2).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of NudC domain-containing protein 2 (NUDCD2).	[2]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of NudC domain-containing protein 2 (NUDCD2).	[3]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of NudC domain-containing protein 2 (NUDCD2).	[4]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of NudC domain-containing protein 2 (NUDCD2).	[5]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of NudC domain-containing protein 2 (NUDCD2).	[6]
Menadione	DMSJDTY	Approved	Menadione affects the expression of NudC domain-containing protein 2 (NUDCD2).	[7]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of NudC domain-containing protein 2 (NUDCD2).	[8]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of NudC domain-containing protein 2 (NUDCD2).	[9]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of NudC domain-containing protein 2 (NUDCD2).	[10]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of NudC domain-containing protein 2 (NUDCD2).	[11]

References

• [1] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [4] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [5] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [6] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [7] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [8] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [9] Isobaric tags for relative and absolute quantitation-based proteomics analysis of the effect of ginger oil on bisphenol A-induced breast cancer cell proliferation. Oncol Lett. 2021 Feb;21(2):101. doi: 10.3892/ol.2020.12362. Epub 2020 Dec 8.
• [10] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [11] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.