Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTG7Q02A)

• DOT Name: C-type lectin domain family 1 member A (CLEC1A)
• Synonyms: C-type lectin-like receptor 1; CLEC-1
• Gene Name: CLEC1A
• UniProt ID: CLC1A_HUMAN
• Pfam ID: PF00059
• Sequence:
  MQAKYSSTRDMLDDDGDTTMSLHSQGSATTRHPEPRRTEHRAPSSTWRPVALTLLTLCLV
  LLIGLAALGLLFFQYYQLSNTGQDTISQMEERLGNTSQELQSLQVQNIKLAGSLQHVAEK
  LCRELYNKAGAHRCSPCTEQWKWHGDNCYQFYKDSKSWEDCKYFCLSENSTMLKINKQED
  LEFAASQSYSEFFYSYWTGLLRPDSGKAWLWMDGTPFTSELFHIIIDVTSPRSRDCVAIL
  NGMIFSKDCKELKRCVCERRAGMVKPESLHVPPETLGEGD
• Tissue Specificity: Expressed preferentially in dendritic cells.

Molecular Interaction Atlas (MIA) of This DOT

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of C-type lectin domain family 1 member A (CLEC1A).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of C-type lectin domain family 1 member A (CLEC1A).	[2]
Pioglitazone	DMKJ485	Approved	Pioglitazone increases the expression of C-type lectin domain family 1 member A (CLEC1A).	[3]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of C-type lectin domain family 1 member A (CLEC1A).	[5]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of C-type lectin domain family 1 member A (CLEC1A).	[4]

References

• [1] Antiepileptic drugs are endocrine disruptors for the human fetal testis ex vivo. Toxicol Sci. 2023 Sep 28;195(2):169-183. doi: 10.1093/toxsci/kfad076.
• [2] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [3] Peroxisome proliferator activated receptor gamma (PPAR-gama) ligand pioglitazone regulated gene networks in term human primary trophoblast cells. Reprod Toxicol. 2018 Oct;81:99-107.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] Comparison of transcriptome expression alterations by chronic exposure to low-dose bisphenol A in different subtypes of breast cancer cells. Toxicol Appl Pharmacol. 2019 Dec 15;385:114814. doi: 10.1016/j.taap.2019.114814. Epub 2019 Nov 9.