Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGVGV02)

• DOT Name: Asparagine synthetase domain-containing protein 1 (ASNSD1)
• Synonyms: HCV NS3-transactivated protein 1
• Gene Name: ASNSD1
• UniProt ID: ASND1_HUMAN
• Pfam ID: PF00733
• Sequence:
  MCGICCSVNFSAEHFSQDLKEDLLYNLKQRGPNSSKQLLKSDVNYQCLFSAHVLHLRGVL
  TTQPVEDERGNVFLWNGEIFSGIKVEAEENDTQILFNYLSSCKNESEILSLFSEVQGPWS
  FIYYQASSHYLWFGRDFFGRRSLLWHFSNLGKSFCLSSVGTQTSGLANQWQEVPASGLFR
  IDLKSTVISGCIILQLYPWKYISRENIIEENVNSLSQISADLPAFVSVVANEAKLYLEKP
  VVPLNMMLPQAALETHCSNISNVPPTREILQVFLTDVHMKEVIQQFIDVLSVAVKKRVLC
  LPRDENLTANEVLKTCDRKANVAILFSGGIDSMVIATLADRHIPLDEPIDLLNVAFIAEE
  KTMPTTFNREGNKQKNKCEIPSEEFSKDVAAAAADSPNKHVSVPDRITGRAGLKELQAVS
  PSRIWNFVEINVSMEELQKLRRTRICHLIRPLDTVLDDSIGCAVWFASRGIGWLVAQEGV
  KSYQSNAKVVLTGIGADEQLAGYSRHRVRFQSHGLEGLNKEIMMELGRISSRNLGRDDRV
  IGDHGKEARFPFLDENVVSFLNSLPIWEKANLTLPRGIGEKLLLRLAAVELGLTASALLP
  KRAMQFGSRIAKMEKINEKASDKCGRLQIMSLENLSIEKETKL

Molecular Interaction Atlas (MIA) of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Asparagine synthetase domain-containing protein 1 (ASNSD1).	[1]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Asparagine synthetase domain-containing protein 1 (ASNSD1).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Asparagine synthetase domain-containing protein 1 (ASNSD1).	[3]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Asparagine synthetase domain-containing protein 1 (ASNSD1).	[4]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Asparagine synthetase domain-containing protein 1 (ASNSD1).	[4]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Asparagine synthetase domain-containing protein 1 (ASNSD1).	[5]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Asparagine synthetase domain-containing protein 1 (ASNSD1).	[6]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Asparagine synthetase domain-containing protein 1 (ASNSD1).	[7]
KOJIC ACID	DMP84CS	Investigative	KOJIC ACID decreases the expression of Asparagine synthetase domain-containing protein 1 (ASNSD1).	[8]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [5] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [6] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [7] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [8] Toxicogenomics of kojic acid on gene expression profiling of a375 human malignant melanoma cells. Biol Pharm Bull. 2006 Apr;29(4):655-69.